Homologs in group_3898
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS09715 | PMI_RS09715 | 30.4 | Proteus mirabilis HI4320 | - | ogr/Delta-like zinc finger family protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS11880 |
| Feature type | CDS |
| Gene | - |
| Product | ogr/Delta-like zinc finger family protein |
| Location | 2623819 - 2624079 (strand: 1) |
| Length | 261 (nucleotides) / 86 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3898 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 1 |
| PF04606 | Ogr/Delta-like zinc finger |
|---|
MRVLTIYCPECGEKAMIKKSNRKHKELTDLYCACRDPLCGHTFVLNLTFSHTLSPSAKKQDALLLAMIKNLSPQQREKALTLLQEI
TTAGGCTAATATAGAAGGTGGTGATAGATTGATAATAAAGAGAAAATACCATGCGTGTTTTAACAATTTACTGTCCTGAATGTGGTGAAAAAGCGATGATAAAGAAAAGTAATCGCAAGCATAAAGAGTTAACAGATCTTTACTGTGCCTGCCGTGATCCGCTTTGTGGGCATACCTTTGTGCTAAATCTTACCTTTAGTCATACTCTAAGTCCCAGCGCCAAAAAACAAGATGCCCTTTTATTAGCAATGATAAAAAATCTCTCGCCACAGCAACGAGAAAAAGCCTTAACCTTGTTACAAGAGATATAACGCTTTTTTACTTACTCTATTTTGCCTTGATTTTATGATCCTGCTCCCAT
