Homologs in group_2479

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00955 FBDBKF_00955 63.0 Morganella morganii S1 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
EHELCC_00590 EHELCC_00590 63.0 Morganella morganii S2 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
NLDBIP_02870 NLDBIP_02870 63.0 Morganella morganii S4 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
LHKJJB_04385 LHKJJB_04385 63.0 Morganella morganii S3 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
HKOGLL_02660 HKOGLL_02660 63.0 Morganella morganii S5 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif

Distribution of the homologs in the orthogroup group_2479

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2479

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAL9 6.81e-42 137 60 0 105 4 ykgJ Uncharacterized protein YkgJ Escherichia coli (strain K12)
P0AAM0 6.81e-42 137 60 0 105 4 ykgJ Uncharacterized protein YkgJ Escherichia coli O157:H7
P31004 1.02e-30 109 47 2 109 4 None Putative ferredoxin Acinetobacter calcoaceticus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09565
Feature type CDS
Gene -
Product YkgJ family cysteine cluster protein
Location 2087483 - 2087866 (strand: 1)
Length 384 (nucleotides) / 127 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2479
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03692 Putative zinc- or iron-chelating domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0727 General function prediction only (R) R Uncharacterized protein YkgJ, contains CxxCxxCC motif

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06940 uncharacterized protein - -

Protein Sequence

MSKHSNDFIYMQDNPCMHCGACCAYFRVSFYWAEMKSGGGVVPDEFTEPLTPFLSCMKGTNEKQPRCEKLIGEVGECVSCAIYEQRPSPCREFEQSWANGVKNEACDRARAAFGLPPLPNISLPHSA

Flanking regions ( +/- flanking 50bp)

TTTCAAAAACTTCTTATATTACTTTAAGGTCAGATAAAACGGTATCTGGTATGAGCAAACATTCTAACGATTTTATTTATATGCAGGATAATCCCTGTATGCATTGTGGTGCATGTTGCGCCTATTTTAGAGTCTCTTTCTATTGGGCTGAAATGAAAAGTGGTGGTGGTGTTGTTCCTGACGAATTTACCGAACCCTTAACCCCTTTTCTATCATGTATGAAAGGAACTAATGAGAAACAACCACGCTGTGAAAAATTGATTGGTGAAGTTGGTGAATGCGTGAGTTGTGCAATTTATGAACAGAGACCATCCCCTTGCCGTGAGTTTGAACAATCTTGGGCTAATGGCGTAAAAAATGAAGCTTGCGATCGGGCAAGAGCCGCTTTTGGGCTTCCTCCTCTTCCTAATATTTCTCTACCGCATTCTGCGTAGAACATCAGAGGGGCTAGCCCCTCCTGAGTCTCTTTGATCACAATTTTGCA