Homologs in group_2510

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00955 FBDBKF_00955 100.0 Morganella morganii S1 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
EHELCC_00590 EHELCC_00590 100.0 Morganella morganii S2 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
NLDBIP_02870 NLDBIP_02870 100.0 Morganella morganii S4 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
LHKJJB_04385 LHKJJB_04385 100.0 Morganella morganii S3 ykgJ Uncharacterized protein YkgJ, contains CxxCxxCC motif
PMI_RS09565 PMI_RS09565 63.0 Proteus mirabilis HI4320 - YkgJ family cysteine cluster protein

Distribution of the homologs in the orthogroup group_2510

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2510

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAL9 4.88e-39 130 55 0 108 4 ykgJ Uncharacterized protein YkgJ Escherichia coli (strain K12)
P0AAM0 4.88e-39 130 55 0 108 4 ykgJ Uncharacterized protein YkgJ Escherichia coli O157:H7
P31004 4.66e-24 92 41 3 120 4 None Putative ferredoxin Acinetobacter calcoaceticus

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02660
Feature type CDS
Gene ykgJ
Product Uncharacterized protein YkgJ, contains CxxCxxCC motif
Location 133731 - 134132 (strand: -1)
Length 402 (nucleotides) / 133 (amino acids)
In genomic island -

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2510
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03692 Putative zinc- or iron-chelating domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0727 General function prediction only (R) R Uncharacterized protein YkgJ, contains CxxCxxCC motif

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06940 uncharacterized protein - -

Protein Sequence

MWLTIMSNVIAFTDADTNPCMQCGACCAYFRVSFYHGETDSTGGVVPAEMTEKVNDFMACMKGTDQKSPRCINLQGEVGQCVACSAYAQRPSPCREFDQSWVSGVHNAACDRARAAHGLPPLEPPSRHNDHAA

Flanking regions ( +/- flanking 50bp)

TATTCAGGACAAAACTCGGTCTGCGGTGAAATAATCACCGCGTTTGCATAATGTGGTTAACTATCATGAGCAATGTAATTGCGTTTACTGATGCGGACACCAATCCCTGTATGCAGTGCGGGGCGTGCTGTGCCTATTTCCGGGTCTCGTTTTATCACGGGGAAACGGACAGTACGGGCGGCGTGGTGCCGGCAGAGATGACAGAAAAAGTGAATGACTTTATGGCCTGTATGAAAGGCACTGATCAGAAATCCCCGCGCTGTATCAATCTTCAGGGCGAAGTCGGTCAGTGTGTGGCGTGCAGCGCTTACGCACAGCGCCCGTCGCCGTGCCGCGAGTTTGATCAGTCGTGGGTCAGCGGTGTACACAATGCCGCCTGTGACCGGGCAAGAGCCGCACACGGCCTGCCGCCGCTGGAGCCGCCGTCCCGCCACAATGATCACGCCGCCTGACCACCGCCGTTTTGCACTAACGCTTTTACGGCTGTTCAGGTAGGATAACC