Homologs in group_2325

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17865 FBDBKF_17865 33.1 Morganella morganii S1 yecT DUF1311 domain-containing protein
EHELCC_09890 EHELCC_09890 33.1 Morganella morganii S2 yecT DUF1311 domain-containing protein
NLDBIP_10270 NLDBIP_10270 33.1 Morganella morganii S4 yecT DUF1311 domain-containing protein
LHKJJB_07485 LHKJJB_07485 33.1 Morganella morganii S3 yecT DUF1311 domain-containing protein
HKOGLL_07035 HKOGLL_07035 33.1 Morganella morganii S5 yecT DUF1311 domain-containing protein
F4V73_RS00015 F4V73_RS00015 30.9 Morganella psychrotolerans - lysozyme inhibitor LprI family protein

Distribution of the homologs in the orthogroup group_2325

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2325

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09555
Feature type CDS
Gene umoC
Product flagellar biogenesis regulator UmoC
Location 2085881 - 2086294 (strand: -1)
Length 414 (nucleotides) / 137 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2325
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07007 Lysozyme inhibitor LprI

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3755 Function unknown (S) S Uncharacterized conserved protein YecT, DUF1311 family

Protein Sequence

MKIGTLLISYSLLTMSLISFSSFAQVNHDPLTKCYELSTDASQTTIKACLLDELRLSEEQLNVIYNKSKGDLEDSDSIAAKSAIDALVSSQEQFILFRSSECQRQSALMMGGNGADEVLLACEIKLNQWRAKLLLTN

Flanking regions ( +/- flanking 50bp)

CTTATATTTGACAGTCAAATTTAGTAAAAAATTTATTATTGGGAGCCAACGTGAAGATAGGTACGCTTTTAATTTCTTACAGTTTACTCACAATGAGTTTGATCTCTTTTTCCTCCTTTGCTCAAGTAAATCACGATCCCCTGACCAAATGTTATGAGTTGTCAACAGATGCAAGCCAAACAACCATTAAAGCTTGTCTATTAGATGAACTAAGATTATCTGAAGAGCAGTTGAATGTTATCTATAATAAAAGCAAAGGCGACCTTGAAGATAGTGACTCTATCGCGGCTAAAAGTGCTATTGATGCATTAGTCAGTTCACAAGAGCAGTTTATTCTTTTTAGAAGTAGTGAATGCCAACGTCAATCTGCTTTAATGATGGGGGGCAATGGTGCTGATGAAGTACTGCTGGCTTGTGAAATAAAATTAAATCAATGGCGAGCTAAATTATTACTCACTAATTAAGCCATAAATACAAAACACCTGTATAAAAGGTGTTTTGTATTTGGGTCAAT