Homologs in group_2357

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_09890 EHELCC_09890 100.0 Morganella morganii S2 yecT DUF1311 domain-containing protein
NLDBIP_10270 NLDBIP_10270 100.0 Morganella morganii S4 yecT DUF1311 domain-containing protein
LHKJJB_07485 LHKJJB_07485 100.0 Morganella morganii S3 yecT DUF1311 domain-containing protein
HKOGLL_07035 HKOGLL_07035 100.0 Morganella morganii S5 yecT DUF1311 domain-containing protein
F4V73_RS00015 F4V73_RS00015 61.2 Morganella psychrotolerans - lysozyme inhibitor LprI family protein
PMI_RS09555 PMI_RS09555 33.1 Proteus mirabilis HI4320 umoC flagellar biogenesis regulator UmoC

Distribution of the homologs in the orthogroup group_2357

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2357

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76296 0.000683 40 25 5 145 4 yecT Uncharacterized protein YecT Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17865
Feature type CDS
Gene yecT
Product DUF1311 domain-containing protein
Location 35171 - 35590 (strand: 1)
Length 420 (nucleotides) / 139 (amino acids)
In genomic island -

Contig

Accession contig_30
Length 36513 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2357
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07007 Lysozyme inhibitor LprI

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3755 Function unknown (S) S Uncharacterized conserved protein YecT, DUF1311 family

Protein Sequence

MNLSRTAVILGIAGLSISFSAVTVAEEKGLSPLEQCYQSAGNAPRTKIAGCLDAKLKAADTRLNTILTQQKQEIASLNSAGSKKAIQSLNLSHSAFITFRDAECRYRYDATLGGSGAGDIMKACQIDLTNWRIKQLQEN

Flanking regions ( +/- flanking 50bp)

TTTATCTGTCAGCCGGACTGCAACGAACAAGACTGAAATAAGGAGTAAGCATGAATTTATCCCGCACTGCTGTAATACTGGGTATCGCCGGTCTGAGCATCAGCTTTTCCGCTGTAACGGTGGCGGAAGAGAAAGGATTAAGCCCGCTGGAGCAATGCTATCAGTCTGCCGGGAATGCACCACGGACAAAAATTGCAGGCTGCCTGGATGCAAAGCTGAAAGCAGCAGATACCCGCCTGAATACGATTTTGACACAGCAAAAACAGGAAATTGCATCACTCAATTCAGCCGGAAGTAAAAAAGCTATTCAGTCACTGAATTTGTCACATTCCGCCTTTATTACTTTCCGCGATGCTGAGTGCCGGTATCGCTATGATGCAACTCTCGGTGGTAGTGGTGCCGGCGATATCATGAAAGCCTGCCAGATTGACCTGACAAATTGGCGGATAAAACAGTTACAGGAAAATTAATTCACAGAAAAAACAGCAGATAACGCTATTCCGGCACAGAAATACCGGCC