Homologs in group_555

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01390 FBDBKF_01390 86.0 Morganella morganii S1 yfhL YfhL family 4Fe-4S dicluster ferredoxin
EHELCC_00155 EHELCC_00155 86.0 Morganella morganii S2 yfhL YfhL family 4Fe-4S dicluster ferredoxin
NLDBIP_03305 NLDBIP_03305 86.0 Morganella morganii S4 yfhL YfhL family 4Fe-4S dicluster ferredoxin
LHKJJB_04820 LHKJJB_04820 86.0 Morganella morganii S3 yfhL YfhL family 4Fe-4S dicluster ferredoxin
HKOGLL_02225 HKOGLL_02225 86.0 Morganella morganii S5 yfhL YfhL family 4Fe-4S dicluster ferredoxin
F4V73_RS02005 F4V73_RS02005 87.2 Morganella psychrotolerans - YfhL family 4Fe-4S dicluster ferredoxin

Distribution of the homologs in the orthogroup group_555

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_555

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52102 5.83e-47 147 79 0 86 1 yfhL Ferredoxin YfhL Escherichia coli (strain K12)
P44746 1.53e-41 133 70 0 86 1 HI_0527 Uncharacterized ferredoxin-like protein HI_0527 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P00208 3.03e-28 100 60 1 80 1 fdx Ferredoxin Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
A9FH21 9.37e-23 86 51 1 84 1 sce8005 Ferredoxin Fdx2 Sorangium cellulosum (strain So ce56)
Q8KBP9 2.1e-15 67 56 0 55 3 CT1736 Ferredoxin-3 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8KCZ6 2.95e-15 66 54 0 55 3 CT1261 Ferredoxin-1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P00207 1.23e-14 65 51 0 58 1 fer1 Ferredoxin-1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P27394 1.49e-14 65 43 0 67 4 frxA Ferredoxin-like protein in nif region Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P00206 3.03e-14 63 50 0 55 1 None Ferredoxin-2 Chlorobium limicola
Q8KCZ7 3.31e-14 63 50 0 56 3 CT1260 Ferredoxin-2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P42711 1.31e-12 60 41 0 58 4 fdxN Ferredoxin-like protein in nif region Rhizobium leguminosarum bv. trifolii
P12712 1.03e-11 57 41 1 62 4 fdxN Ferredoxin-like protein in nif region Rhizobium meliloti (strain 1021)
P00204 1.57e-11 57 53 1 54 1 None Ferredoxin-1 Chlorobium limicola
P11054 2.77e-11 57 41 0 62 4 None Ferredoxin-like protein in nif region Azotobacter vinelandii
P00205 3.6e-11 56 57 0 45 1 None Ferredoxin Chlorobaculum thiosulfatiphilum
Q53204 2.61e-10 54 41 0 58 4 fdxN Ferredoxin-like protein in nif region Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P00198 2.16e-09 51 46 1 56 1 fdxA 4Fe-4S ferredoxin FdxA Gottschalkia acidurici (strain ATCC 7906 / DSM 604 / BCRC 14475 / CIP 104303 / KCTC 5404 / NCIMB 10678 / 9a)
D5ARY6 5.92e-08 48 44 1 61 1 fdxN Ferredoxin-1 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CY90 5.92e-08 48 44 1 61 3 fdxN Ferredoxin-1 Rhodobacter capsulatus
P80168 1.53e-07 47 42 1 56 1 CLOST_2292 Ferredoxin Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
P07508 6.3e-07 45 43 1 55 1 None Ferredoxin Acetivibrio thermocellus
P12415 1.52e-06 45 33 3 80 4 fdxN Ferredoxin-like protein in nif region Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P00200 2.08e-06 43 40 1 54 1 None Ferredoxin Thermoanaerobacterium thermosaccharolyticum
P00195 2.25e-06 43 39 1 56 1 None Ferredoxin Clostridium pasteurianum
P00197 1.09e-05 42 41 1 55 1 None Ferredoxin Clostridium sp. (strain M-E)
P22846 1.55e-05 41 39 1 56 1 fer Ferredoxin Clostridium perfringens (strain 13 / Type A)
P0A3D4 2.88e-05 42 32 3 80 4 fdxN Ferredoxin-like protein in nif region Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P0A3D5 2.88e-05 42 32 3 80 4 fdxN Ferredoxin-like protein in nif region Trichormus azollae
P00194 3.47e-05 40 38 1 55 1 None Ferredoxin-1 Rhodospirillum rubrum
Q45560 8.89e-05 40 32 3 80 1 fdxA Ferredoxin 7Fe Hydrogenibacillus schlegelii
P14073 9.2e-05 39 42 1 54 1 None Ferredoxin Butyribacterium methylotrophicum
P03941 0.000156 39 38 3 76 1 None Ferredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
P00196 0.000226 38 34 1 55 1 None Ferredoxin Clostridium butyricum
P06123 0.000366 38 38 2 57 4 None Ferredoxin-like protein in vnf region Azotobacter chroococcum mcd 1
P14939 0.000374 38 40 2 57 4 None Ferredoxin-like protein in vnf region Azotobacter vinelandii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09295
Feature type CDS
Gene -
Product YfhL family 4Fe-4S dicluster ferredoxin
Location 2031349 - 2031609 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_555
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12838 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2768 Function unknown (S) S Uncharacterized Fe-S cluster protein

Protein Sequence

MALLITKKCINCDMCEPECPNDAISMGNDIYEINPDLCTECVGHYDKPTCQSVCPITNTIIIDPAHTESQDELWEKFVLIHHADKI

Flanking regions ( +/- flanking 50bp)

GCAAGATATAAGTTACTGTAATTTAATAATTTATATATTAAGTGACTGATATGGCTTTACTAATTACGAAGAAATGCATCAACTGCGATATGTGTGAACCCGAATGTCCTAACGATGCCATTTCAATGGGGAATGATATTTATGAAATCAATCCTGATCTTTGCACTGAATGTGTAGGACATTATGATAAACCGACTTGTCAGTCGGTATGCCCTATCACGAATACAATTATCATCGATCCTGCTCATACTGAATCGCAAGATGAATTATGGGAAAAGTTTGTACTGATCCACCACGCTGACAAAATCTAAGCAAACGCAATCGGGAATAAATTTAAGCGTTATTTTTCTAAAATAACGGT