Homologs in group_539

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01240 FBDBKF_01240 59.3 Morganella morganii S1 tadA tRNA adenosine(34) deaminase TadA
EHELCC_00305 EHELCC_00305 59.3 Morganella morganii S2 tadA tRNA adenosine(34) deaminase TadA
NLDBIP_03155 NLDBIP_03155 59.3 Morganella morganii S4 tadA tRNA adenosine(34) deaminase TadA
LHKJJB_04670 LHKJJB_04670 59.3 Morganella morganii S3 tadA tRNA adenosine(34) deaminase TadA
HKOGLL_02375 HKOGLL_02375 59.3 Morganella morganii S5 tadA tRNA adenosine(34) deaminase TadA
F4V73_RS07280 F4V73_RS07280 56.9 Morganella psychrotolerans tadA tRNA adenosine(34) deaminase TadA

Distribution of the homologs in the orthogroup group_539

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_539

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQ08 3.83e-73 220 65 0 158 3 tadA tRNA-specific adenosine deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGY4 3.83e-73 220 65 0 158 3 tadA tRNA-specific adenosine deaminase Salmonella typhi
P68397 4e-73 220 64 0 154 3 tadA tRNA-specific adenosine deaminase Shigella flexneri
P68398 4e-73 220 64 0 154 1 tadA tRNA-specific adenosine deaminase Escherichia coli (strain K12)
Q8FF24 4.92e-73 220 64 0 154 3 tadA tRNA-specific adenosine deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XA44 4.92e-73 220 64 0 154 3 tadA tRNA-specific adenosine deaminase Escherichia coli O157:H7
P44931 6.19e-66 202 64 1 147 3 tadA tRNA-specific adenosine deaminase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q99W51 9.86e-51 163 50 0 154 1 tadA tRNA-specific adenosine deaminase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P57343 1.18e-49 160 47 0 153 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AM8 5.59e-49 159 53 2 150 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9R4 4.48e-48 156 48 3 150 3 tadA tRNA-specific adenosine deaminase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P21335 5.59e-44 146 48 1 145 1 tadA tRNA-specific adenosine deaminase Bacillus subtilis (strain 168)
Q8P2R7 5.27e-42 140 41 0 154 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DA21 9.48e-42 140 41 0 153 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XE14 9.48e-42 140 41 0 153 1 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA20 9.48e-42 140 41 0 153 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68999 4.16e-41 139 41 0 153 3 tadA tRNA-specific adenosine deaminase Streptococcus pyogenes serotype M1
O67050 3.89e-35 123 42 1 144 1 tadA tRNA-specific adenosine deaminase Aquifex aeolicus (strain VF5)
A9CK16 4.46e-35 123 41 0 144 1 tadA tRNA-specific adenosine deaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9S7I0 1.31e-34 131 44 3 170 1 TADA tRNA(adenine(34)) deaminase, chloroplastic Arabidopsis thaliana
Q1RGK7 9.67e-34 119 44 2 144 3 tadA tRNA-specific adenosine deaminase Rickettsia bellii (strain RML369-C)
Q92G39 6.91e-31 112 42 1 144 3 tadA tRNA-specific adenosine deaminase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q68Y02 7.65e-30 109 42 2 144 3 tadA tRNA-specific adenosine deaminase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UJW9 9.06e-30 109 41 1 144 3 tadA tRNA-specific adenosine deaminase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCC6 7.84e-29 107 40 1 145 3 tadA tRNA-specific adenosine deaminase Rickettsia prowazekii (strain Madrid E)
C1D1Q9 3.41e-23 98 41 3 147 3 tilS tRNA(Ile)-lysidine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q0P4H0 1.13e-22 92 30 3 163 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus tropicalis
Q5RIV4 2.21e-22 92 34 4 170 2 adat2 tRNA-specific adenosine deaminase 2 Danio rerio
Q5E9J7 5.3e-22 90 31 4 164 2 DEADC1 tRNA-specific adenosine deaminase 2 Bos taurus
Q4V7V8 7.7e-22 90 30 3 162 2 adat2 tRNA-specific adenosine deaminase 2 Xenopus laevis
O34598 3.95e-21 87 49 1 93 1 guaD Guanine deaminase Bacillus subtilis (strain 168)
Q7Z6V5 1.96e-20 86 29 4 164 1 ADAT2 tRNA-specific adenosine deaminase 2 Homo sapiens
Q94BU8 4.51e-20 85 43 1 100 1 GSDA Guanosine deaminase Arabidopsis thaliana
Q6P6J0 2.04e-19 84 29 3 162 1 Adat2 tRNA-specific adenosine deaminase 2 Mus musculus
Q72IF6 1.27e-18 85 41 5 124 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SI38 1.4e-18 85 41 5 124 3 tilS tRNA(Ile)-lysidine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9RV23 2.06e-17 82 42 4 137 3 tilS tRNA(Ile)-lysidine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6IDB6 4.18e-15 72 29 4 162 1 TAD2 tRNA-specific adenosine deaminase TAD2 Arabidopsis thaliana
O94642 4.07e-14 72 28 1 139 1 tad2 tRNA-specific adenosine deaminase subunit tad2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P78594 4.21e-14 68 30 5 152 3 FCA1 Cytosine deaminase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6PAT0 9.38e-14 71 46 1 65 1 Adat3 Probable inactive tRNA-specific adenosine deaminase-like protein 3 Mus musculus
Q96EY9 1.79e-13 70 31 5 152 1 ADAT3 Probable inactive tRNA-specific adenosine deaminase-like protein 3 Homo sapiens
Q561R2 1.9e-13 70 38 1 90 2 Adat3 Probable inactive tRNA-specific adenosine deaminase-like protein 3 Rattus norvegicus
O59834 3.95e-13 67 34 2 102 3 SPCC965.14c Probable cytosine deaminase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P57533 1.2e-12 65 32 6 156 3 ribD1 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O66534 3.23e-12 66 35 4 126 3 ribD Riboflavin biosynthesis protein RibD Aquifex aeolicus (strain VF5)
Q8JFW4 6.12e-12 65 48 1 68 2 adat3 Probable inactive tRNA-specific adenosine deaminase-like protein 3 Danio rerio
Q8K9A4 1.63e-11 62 30 6 159 3 ribD1 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P47058 6.41e-11 62 28 5 169 1 TAD2 tRNA-specific adenosine deaminase subunit TAD2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q12178 6.48e-11 60 31 6 144 1 FCY1 Cytosine deaminase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B6TRH4 1.23e-10 62 32 6 137 2 PYRD Riboflavin biosynthesis protein PYRD, chloroplastic Zea mays
Q89AB0 3.32e-10 61 31 6 152 3 ribD Riboflavin biosynthesis protein RibD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8GWP5 6.88e-10 60 28 7 180 1 PYRD Riboflavin biosynthesis protein PYRD, chloroplastic Arabidopsis thaliana
P17618 7.22e-09 57 29 6 152 1 ribD Riboflavin biosynthesis protein RibD Bacillus subtilis (strain 168)
P25539 8.66e-09 57 30 7 155 1 ribD Riboflavin biosynthesis protein RibD Escherichia coli (strain K12)
P70814 8.88e-09 57 31 6 152 3 ribD Riboflavin biosynthesis protein RibD Bacillus amyloliquefaciens
P50853 3.89e-08 55 32 6 156 3 ribD Riboflavin biosynthesis protein RibD Actinobacillus pleuropneumoniae
Q9URQ3 1.03e-07 53 36 1 68 1 TAD3 tRNA-specific adenosine deaminase subunit TAD3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WPH1 4.79e-07 52 32 7 140 1 ribD Riboflavin biosynthesis protein RibD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPH0 4.79e-07 52 32 7 140 3 ribD Riboflavin biosynthesis protein RibD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9P7N4 4.87e-06 48 36 0 63 3 tad3 tRNA-specific adenosine deaminase subunit tad3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
F4KH86 1.05e-05 48 32 0 61 1 TAD3 tRNA-specific adenosine deaminase TAD3 Arabidopsis thaliana
P87241 8.16e-05 45 29 3 124 3 rib2 Diaminohydroxyphosphoribosylamino-pyrimidine deaminase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P32393 0.000137 43 30 5 121 3 comEB ComE operon protein 2 Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09290
Feature type CDS
Gene tadA
Product tRNA adenosine(34) deaminase TadA
Location 2030506 - 2031036 (strand: -1)
Length 531 (nucleotides) / 176 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_539
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF14437 MafB19-like deaminase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0590 Translation, ribosomal structure and biogenesis (J) J tRNA(Arg) A34 adenosine deaminase TadA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11991 tRNA(adenine34) deaminase [EC:3.5.4.33] - -

Protein Sequence

MNKIKDDIYWMHKAIEQAHKAQQLGEIPVGAVLVAENKIIAKGWNHSIIDNDPTAHAEIMALRKGGKHLQNYRLLDATLYITLEPCVMCAGAIVHSRVKRVVYGASDLKTGAAGSFIDILQHPGMNHKVEITSGVLGEECAQLLSQFFKMRRAEKKQLKQQQRLITQGLIIQEKAK

Flanking regions ( +/- flanking 50bp)

TCTAAAACAGGCTACAATACCGCGCTGTATAATAATGAAGAGATGTTCTTGTGAATAAAATTAAAGATGATATTTATTGGATGCATAAAGCGATTGAGCAGGCACATAAAGCACAACAACTCGGTGAAATTCCTGTAGGAGCCGTGTTAGTCGCTGAGAATAAAATCATTGCTAAAGGTTGGAATCACTCCATTATTGATAATGATCCTACTGCACATGCGGAAATTATGGCATTGCGTAAAGGTGGGAAACATCTACAGAATTATCGCCTACTTGACGCCACATTATATATCACGTTAGAGCCTTGCGTTATGTGTGCTGGAGCAATTGTACATAGTCGTGTAAAAAGAGTGGTCTATGGTGCATCTGATCTAAAAACAGGTGCCGCAGGCTCATTTATTGATATTTTGCAACATCCCGGGATGAACCATAAAGTTGAAATAACATCGGGTGTTTTAGGTGAGGAGTGTGCACAACTCTTGAGCCAGTTTTTTAAGATGAGAAGGGCAGAGAAAAAACAACTGAAACAACAGCAACGTTTAATTACTCAAGGTTTAATCATACAAGAGAAAGCCAAATAGCATCTATTTGGCTTAATTGTTATTGGTAATTGAGTGTATAGGTTGCTTGT