Homologs in group_520

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01105 FBDBKF_01105 85.9 Morganella morganii S1 iscX Fe-S cluster assembly protein IscX
EHELCC_00440 EHELCC_00440 85.9 Morganella morganii S2 iscX Fe-S cluster assembly protein IscX
NLDBIP_03020 NLDBIP_03020 85.9 Morganella morganii S4 iscX Fe-S cluster assembly protein IscX
LHKJJB_04535 LHKJJB_04535 85.9 Morganella morganii S3 iscX Fe-S cluster assembly protein IscX
HKOGLL_02510 HKOGLL_02510 85.9 Morganella morganii S5 iscX Fe-S cluster assembly protein IscX
F4V73_RS07175 F4V73_RS07175 89.1 Morganella psychrotolerans iscX Fe-S cluster assembly protein IscX

Distribution of the homologs in the orthogroup group_520

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_520

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FF46 7.4e-36 117 85 0 64 3 iscX Protein IscX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C0M1 1.92e-35 116 85 0 64 3 iscX Protein IscX Shigella flexneri
P0C0L9 1.92e-35 116 85 0 64 1 iscX Protein IscX Escherichia coli (strain K12)
P0C0M0 1.92e-35 116 85 0 64 1 iscX Protein IscX Escherichia coli O157:H7
P44668 3.73e-29 100 73 0 64 3 iscX Protein IscX Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q51384 2e-15 66 45 0 62 4 PA3808 Uncharacterized protein PA3808 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09150
Feature type CDS
Gene iscX
Product Fe-S cluster assembly protein IscX
Location 1997036 - 1997230 (strand: -1)
Length 195 (nucleotides) / 64 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_520
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04384 Iron-sulphur cluster assembly

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2975 Posttranslational modification, protein turnover, chaperones (O) O Fe-S-cluster formation regulator IscX/YfhJ

Protein Sequence

MKWSDTREIGEALYDLYPDTDPKTVRFTDMHQWICQLDDFDDDPQKSNEKILEAILLVWLDEFE

Flanking regions ( +/- flanking 50bp)

CTAAATATTCTATCAACCATGCGAGAGAACACTGATTTTAGGAGTTTAAAATGAAATGGAGTGATACACGTGAAATAGGGGAAGCGCTTTATGATCTCTACCCCGATACAGATCCAAAAACCGTTCGTTTTACCGATATGCATCAGTGGATTTGCCAATTAGACGATTTTGATGATGATCCACAAAAATCGAATGAAAAAATTCTTGAAGCAATTTTATTAGTTTGGCTTGATGAATTTGAATAATCGAGTAAATGATTAATGCGAAAGACTGGTTAATTGCCAGTCTTTTTGTT