Homologs in group_1928

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14345 FBDBKF_14345 69.6 Morganella morganii S1 prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase
EHELCC_07935 EHELCC_07935 69.6 Morganella morganii S2 prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase
NLDBIP_08260 NLDBIP_08260 69.6 Morganella morganii S4 prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase
LHKJJB_06005 LHKJJB_06005 69.6 Morganella morganii S3 prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase
HKOGLL_04910 HKOGLL_04910 69.6 Morganella morganii S5 prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase
F4V73_RS02560 F4V73_RS02560 67.6 Morganella psychrotolerans prmB 50S ribosomal protein L3 N(5)-glutamine methyltransferase

Distribution of the homologs in the orthogroup group_1928

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1928

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A293 2.44e-157 444 68 0 305 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A294 2.44e-157 444 68 0 305 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhi
Q32DK7 3.25e-155 439 66 0 306 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
P39199 5.88e-155 438 66 0 306 1 prmB Ribosomal protein uL3 glutamine methyltransferase Escherichia coli (strain K12)
Q0WDE1 8.67e-148 420 62 0 306 3 prmB Ribosomal protein uL3 glutamine methyltransferase Yersinia pestis
Q9KQ83 1.13e-144 412 61 0 306 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45106 1.29e-143 410 63 1 303 3 prmB Ribosomal protein uL3 glutamine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CNN7 9.83e-143 407 63 0 294 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pasteurella multocida (strain Pm70)
P39200 5.68e-142 405 60 0 306 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio anguillarum (strain ATCC 68554 / 775)
Q5E3U5 5.68e-142 405 59 0 306 3 prmB Ribosomal protein uL3 glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8ECQ4 2.71e-139 399 63 2 308 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9I347 5.32e-117 342 56 0 295 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5NEL0 1.7e-103 308 46 1 304 3 prmB Ribosomal protein uL3 glutamine methyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q5F783 1.14e-99 298 53 2 294 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JYC0 8.82e-98 293 52 2 294 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JTA1 1.15e-97 293 52 2 294 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7VXJ6 8.38e-92 278 47 2 290 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8P7Q8 3.33e-88 269 47 3 297 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87DS5 1.55e-80 249 43 2 308 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PDL1 4.86e-80 248 43 2 308 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
Q63SZ9 3.38e-79 246 43 4 296 3 prmB Ribosomal protein uL3 glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q89DG5 4.01e-78 243 44 2 296 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9WBM9 7.6e-33 125 36 5 238 3 prmC Release factor glutamine methyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q8KCD5 6.07e-31 120 39 5 188 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9PD67 7.16e-29 114 40 2 185 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
Q8DPZ3 2.07e-28 113 38 5 205 3 prmC Release factor glutamine methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q87DF7 2.05e-27 110 39 2 185 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8DHV7 3.81e-27 110 40 4 193 3 prmC Release factor glutamine methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7NJS7 4.96e-27 110 35 2 207 3 prmC Release factor glutamine methyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q748B2 5.51e-27 110 35 4 205 3 prmC Release factor glutamine methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P45873 1.91e-26 108 32 8 259 3 prmC Release factor glutamine methyltransferase Bacillus subtilis (strain 168)
Q7ULT2 3.4e-26 108 35 5 197 3 prmC Release factor glutamine methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q81JX2 8.84e-26 106 32 9 260 3 prmC Release factor glutamine methyltransferase Bacillus anthracis
O51215 9.18e-26 106 36 4 180 3 prmC Release factor glutamine methyltransferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q97F67 8.37e-25 104 33 2 183 3 prmC Release factor glutamine methyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8PC99 1.12e-24 103 36 1 193 3 prmC Release factor glutamine methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q2RFW1 1.49e-24 103 34 1 210 3 prmC Release factor glutamine methyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q814U1 2.99e-24 102 31 8 260 3 prmC Release factor glutamine methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8A1D7 1.09e-23 100 35 8 240 3 prmC Release factor glutamine methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B5YIQ8 2.66e-23 100 32 5 210 3 prmC Release factor glutamine methyltransferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8EAR4 3.98e-23 99 31 5 257 3 prmC Release factor glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7CIA2 5.89e-23 99 34 3 204 3 prmC Release factor glutamine methyltransferase Yersinia pestis
Q9CHX0 7.53e-23 98 32 6 219 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q7W022 7.77e-23 98 37 3 187 3 prmC Release factor glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q5F5B4 8.47e-23 98 38 3 177 3 prmC Release factor glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8R619 1.2e-22 99 32 4 204 3 prmC Release factor glutamine methyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q68VR6 1.49e-22 100 32 4 221 3 prmC/trmB Bifunctional methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UJU4 2.63e-22 100 29 5 274 3 prmC/trmB Bifunctional methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q6MU88 4.96e-22 96 30 9 231 3 prmC Release factor glutamine methyltransferase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8F987 3.29e-21 94 35 7 209 3 prmC Release factor glutamine methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q1RH40 9.35e-21 95 28 5 265 3 prmC/trmB Bifunctional methyltransferase Rickettsia bellii (strain RML369-C)
Q1II29 1.15e-20 92 32 5 220 3 prmC Release factor glutamine methyltransferase Koribacter versatilis (strain Ellin345)
Q98G94 1.71e-20 92 42 2 132 3 prmC Release factor glutamine methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2RWE0 1.88e-20 93 31 3 215 3 prmC Release factor glutamine methyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P0ACC2 2.01e-20 92 31 3 211 3 prmC Release factor glutamine methyltransferase Shigella flexneri
P0ACC1 2.01e-20 92 31 3 211 1 prmC Release factor glutamine methyltransferase Escherichia coli (strain K12)
Q9ZCB3 2.21e-20 94 30 5 221 3 prmC/trmB Bifunctional methyltransferase Rickettsia prowazekii (strain Madrid E)
A9CG70 2.37e-20 92 35 4 201 3 prmC Release factor glutamine methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8Y4A9 2.48e-20 92 36 4 194 3 prmC Release factor glutamine methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6F0I4 3.78e-20 91 31 5 183 3 prmC Release factor glutamine methyltransferase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q32GZ5 4.41e-20 91 31 3 211 3 prmC Release factor glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q89AT0 7.76e-20 90 28 3 212 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P40816 7.92e-20 90 37 2 181 3 prmC Release factor glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B8E004 1.65e-19 89 30 3 210 3 prmC Release factor glutamine methyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q9K4E3 2.45e-19 89 35 8 212 3 prmC Release factor glutamine methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q92G13 2.55e-19 91 29 4 238 3 prmC/trmB Bifunctional methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9RXR2 3e-19 89 32 2 180 3 prmC Release factor glutamine methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3J2B7 3.63e-19 88 32 7 266 3 prmC Release factor glutamine methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9HVC8 5.15e-19 88 33 3 214 3 prmC Release factor glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9WYV8 6.69e-19 88 29 5 207 1 prmC Release factor glutamine methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q83AD8 1.77e-18 86 33 4 197 3 prmC Release factor glutamine methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q89XT8 3.28e-18 86 31 4 210 3 prmC Release factor glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6H162 4.8e-18 85 32 8 221 3 prmC Release factor glutamine methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
P74003 9.08e-18 85 34 4 188 3 prmC Release factor glutamine methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5NIA7 1.3e-17 84 27 6 289 3 prmC Release factor glutamine methyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q727D9 2.66e-17 84 29 6 220 3 prmC Release factor glutamine methyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O84027 4.12e-17 83 30 6 221 3 prmC Release factor glutamine methyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0B9D1 6.36e-17 82 29 6 221 1 prmC Release factor glutamine methyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q2S0V8 7.41e-17 82 32 3 195 3 prmC Release factor glutamine methyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q8K9W9 3.35e-16 80 34 4 178 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O66506 3.64e-16 80 28 4 193 3 prmC Release factor glutamine methyltransferase Aquifex aeolicus (strain VF5)
Q9A9T7 1.24e-15 79 29 1 192 3 prmC Release factor glutamine methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5E6T2 1.37e-15 79 32 7 213 3 prmC Release factor glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KQ26 1.58e-15 78 30 9 260 3 prmC Release factor glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45253 3.52e-15 77 29 6 211 3 prmC Release factor glutamine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5HY34 4.72e-15 77 31 4 199 3 prmC Release factor glutamine methyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Q9Y5R4 1.89e-14 76 29 5 234 1 HEMK1 MTRF1L release factor glutamine methyltransferase Homo sapiens
Q831F7 3.6e-14 74 28 3 176 3 prmC Release factor glutamine methyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q63QE9 8.49e-14 73 31 2 188 3 prmC Release factor glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q8G3P4 1.41e-13 73 28 4 214 3 prmC Release factor glutamine methyltransferase Bifidobacterium longum (strain NCC 2705)
Q2FWE1 1.66e-13 72 30 5 178 3 prmC Release factor glutamine methyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q921L7 7.08e-13 71 29 6 234 2 Hemk1 MTRF1L release factor glutamine methyltransferase Mus musculus
P57269 8.36e-13 70 30 3 175 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9CN82 1.56e-12 70 32 7 219 3 prmC Release factor glutamine methyltransferase Pasteurella multocida (strain Pm70)
Q7VDL7 8.62e-12 68 32 4 185 3 prmC Release factor glutamine methyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q49404 3.35e-11 67 31 5 164 4 MG259 Uncharacterized protein MG259 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75419 3.69e-10 63 25 5 207 4 MPN_362 Uncharacterized protein MG259 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O14028 4.81e-10 63 26 9 216 3 mtq1 Probable MRF1 mitochondrial N(5)-glutamine methyltransferase mtq1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P72542 6.54e-10 62 28 4 183 1 papM 4-amino-L-phenylalanine/4-methylamino-L-phenylalanine methyltransferase Streptomyces pristinaespiralis
P0DJB1 8.96e-10 62 29 4 175 3 prmC Release factor glutamine methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QDG2 8.96e-10 62 29 4 175 3 prmC Release factor glutamine methyltransferase Corynebacterium glutamicum (strain R)
P45832 9.78e-10 62 27 4 193 3 prmC Release factor glutamine methyltransferase Mycobacterium leprae (strain TN)
A0R213 1.05e-09 61 29 5 193 3 prmC Release factor glutamine methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q87SB8 7.86e-09 58 36 0 80 3 VP0506 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0VP64 5.64e-08 57 30 5 128 3 rsmC Ribosomal RNA small subunit methyltransferase C Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q58338 6.58e-08 55 31 6 124 3 MJ0928 Putative protein N5-glutamine methyltransferase MJ0928 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B8F678 1.48e-07 55 25 3 182 3 HAPS_1234 tRNA1(Val) (adenine(37)-N6)-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
B2VI36 1.51e-07 55 30 5 143 3 ETA_09820 tRNA1(Val) (adenine(37)-N6)-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C4LCN4 1.74e-07 54 29 3 113 3 Tola_0970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7MNQ4 1.89e-07 54 30 0 78 3 VV0662 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain YJ016)
A3N3J4 2.14e-07 54 30 4 127 3 APL_1900 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MXM2 2.16e-07 54 32 0 80 3 VIBHAR_00953 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
B7VJ58 2.28e-07 54 25 2 140 3 VS_0507 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio atlanticus (strain LGP32)
B3H2W9 2.83e-07 53 30 4 127 3 APP7_1987 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9K623 3.85e-07 53 36 2 83 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C6Y2G0 4.97e-07 53 38 0 80 3 Phep_2972 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)
C6VS84 8.04e-07 52 32 0 84 3 Dfer_5119 tRNA1(Val) (adenine(37)-N6)-methyltransferase Dyadobacter fermentans (strain ATCC 700827 / DSM 18053 / CIP 107007 / KCTC 52180 / NS114)
A0KPC4 9.11e-07 52 30 4 134 3 AHA_3669 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8DEQ3 1.07e-06 52 30 0 78 3 VV1_0533 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain CMCP6)
C3LSR6 1.46e-06 52 29 0 86 3 VCM66_0619 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU62 1.46e-06 52 29 0 86 3 VC_0661 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6LD46 1.55e-06 52 34 5 132 3 BDI_1875 tRNA1(Val) (adenine(37)-N6)-methyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A6GWI6 3.3e-06 50 33 6 135 3 FP0346 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
C6DY35 3.96e-06 51 30 6 156 3 prmA Ribosomal protein L11 methyltransferase Geobacter sp. (strain M21)
P9WHV3 4.84e-06 50 26 6 196 1 prmC Release factor glutamine methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q03920 5.66e-06 50 32 8 152 1 MTQ2 eRF1 methyltransferase catalytic subunit MTQ2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53944 6.37e-06 50 25 5 158 1 MTQ1 Mitochondrial MRF1 N(5)-glutamine methyltransferase MTQ1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A4SRS5 6.37e-06 50 33 4 122 3 ASA_3636 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas salmonicida (strain A449)
P9WHV2 6.84e-06 50 26 6 196 3 prmC Release factor glutamine methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q15NR8 8.03e-06 50 33 4 100 3 Patl_3970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5E7Q6 1.26e-05 49 29 0 79 3 VF_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9T8 1.28e-05 49 29 0 81 3 VFMJ11_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain MJ11)
Q12JX1 1.49e-05 49 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4TKY7 2.23e-05 48 35 2 79 3 YPDSF_1562 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CKF3 2.23e-05 48 35 2 79 3 YPN_1197 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3Z3 2.23e-05 48 35 2 79 3 YpAngola_A3602 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q1C564 2.23e-05 48 35 2 79 3 YPA_2443 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFT0 2.23e-05 48 35 2 79 3 YpsIP31758_1127 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JRB8 2.44e-05 48 35 2 79 3 YPK_1180 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A1SZ19 2.48e-05 48 26 3 130 3 rsmC Ribosomal RNA small subunit methyltransferase C Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6L532 2.5e-05 48 38 1 75 3 BVU_3164 tRNA1(Val) (adenine(37)-N6)-methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q667U2 2.62e-05 48 35 2 79 3 YPTB2899 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74SR9 2.62e-05 48 35 2 79 3 YPO2709 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis
B2KA56 2.62e-05 48 35 2 79 3 YPTS_3010 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A0LXM6 2.76e-05 48 31 5 131 3 GFO_0132 tRNA1(Val) (adenine(37)-N6)-methyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A5FKD7 2.86e-05 48 37 2 85 3 Fjoh_1299 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
C6X2D2 3.77e-05 47 29 0 77 3 FIC_02159 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacteriaceae bacterium (strain 3519-10)
Q9CJZ9 4.17e-05 47 36 2 82 3 PM1839 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pasteurella multocida (strain Pm70)
A9MGW2 4.36e-05 47 28 6 142 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1KHR8 5.67e-05 47 32 3 101 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella woodyi (strain ATCC 51908 / MS32)
A5UA66 5.92e-05 47 32 2 80 3 CGSHiEE_00885 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittEE)
B4F055 8.34e-05 47 32 2 80 3 PMI1896 tRNA1(Val) (adenine(37)-N6)-methyltransferase Proteus mirabilis (strain HI4320)
A0L0V1 8.52e-05 47 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain ANA-3)
Q0HMF0 9.08e-05 47 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain MR-4)
Q0HRD8 9.84e-05 47 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain MR-7)
Q24SS5 0.000111 47 38 2 73 3 prmA Ribosomal protein L11 methyltransferase Desulfitobacterium hafniense (strain Y51)
P96188 0.000113 47 28 5 159 3 xamIM Type II methyltransferase M.XamI Xanthomonas campestris pv. amaranthicola
B8FUN2 0.000115 46 38 2 73 3 prmA Ribosomal protein L11 methyltransferase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A8AD10 0.000115 46 32 2 82 3 CKO_00207 tRNA1(Val) (adenine(37)-N6)-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P37872 0.000129 45 32 3 76 3 ybxB Uncharacterized protein YbxB Bacillus subtilis (strain 168)
A5UBC5 0.000134 46 34 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain PittEE)
A5UGT6 0.00014 45 31 2 80 3 CGSHiGG_05325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittGG)
A5G9G5 0.000168 46 28 5 153 3 prmA Ribosomal protein L11 methyltransferase Geotalea uraniireducens (strain Rf4)
Q8A9H7 0.000172 45 29 5 131 3 BT_0838 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A3QHZ8 0.000215 46 30 4 119 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A6WJH4 0.000219 46 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS185)
Q8EIL1 0.000221 45 32 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L1V0 0.000221 45 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS195)
A3D8E4 0.000223 45 33 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella baltica (strain OS155 / ATCC BAA-1091)
B6EMW5 0.000265 45 27 3 127 3 VSAL_I0559 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio salmonicida (strain LFI1238)
B0BU33 0.000276 45 33 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A1RG35 0.000323 45 32 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella sp. (strain W3-18-1)
A4YA93 0.000323 45 32 3 95 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q4QPN2 0.000365 45 34 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain 86-028NP)
B3GZF1 0.000381 45 33 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q4QNC1 0.0004 44 30 2 81 3 NTHI0547 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain 86-028NP)
P44453 0.000469 45 34 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFI6 0.000482 45 34 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Haemophilus influenzae (strain PittGG)
Q088B4 0.000486 45 34 2 79 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella frigidimarina (strain NCIMB 400)
A3N3U3 0.00055 44 33 2 81 3 rsmC Ribosomal RNA small subunit methyltransferase C Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q87WA9 0.000598 44 28 3 143 3 rlmG Ribosomal RNA large subunit methyltransferase G Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7N1W7 0.000649 44 35 2 80 3 plu3348 tRNA1(Val) (adenine(37)-N6)-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q89AI2 0.000672 44 23 3 121 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1S321 0.000714 44 35 2 79 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q57G51 0.000856 44 30 2 79 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella choleraesuis (strain SC-B67)
Q18511 0.000862 43 27 1 92 1 metl-5 rRNA N6-adenosine-methyltransferase metl-5 Caenorhabditis elegans

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08840
Feature type CDS
Gene prmB
Product 50S ribosomal protein L3 N(5)-glutamine methyltransferase
Location 1933105 - 1934037 (strand: -1)
Length 933 (nucleotides) / 310 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1928
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05175 Methyltransferase small domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2890 Translation, ribosomal structure and biogenesis (J) J Methylase of polypeptide chain release factors

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07320 ribosomal protein L3 glutamine methyltransferase [EC:2.1.1.298] - -

Protein Sequence

MDITAKEEAVADLSTILDMLRWAMSQFNSSDIYYGHGTDNAWDEALQLVLPTLALPLDIPDALLSTKLTTSEKMEIIQLIEVRIEQKIPVPYLTHRAWFCGHEFYVDERVLIPRSPIGELINNHFAGLIGQEPTRILDLCTGSGCIAIACAHEFQEAEVDAVDISADALEVAEFNIENHGLIHRVYPMQSDLFEAIVPTPYDIIVTNPPYVDAEDMGDLPDEYHIEPELALASGVDGLDITRQILLKAPDYLSEKGILVCEVGNSMVHLIEQFPEVPFTWLEFEKGGIGVFMLTREQLVEFSDSFASDKR

Flanking regions ( +/- flanking 50bp)

GGCAAACTACAGACTTTCTATTTCGTCAGATCCGTCAGAGGACAACAGTTTTGGATATCACAGCAAAAGAAGAAGCCGTAGCTGATTTAAGCACGATCTTAGATATGTTACGTTGGGCTATGAGTCAGTTTAATTCATCAGATATTTATTATGGTCATGGTACGGATAACGCATGGGATGAAGCGTTACAGCTTGTTCTACCTACACTGGCTCTTCCTTTAGATATTCCTGATGCTCTTTTATCAACCAAACTTACAACCTCTGAAAAAATGGAAATCATTCAACTTATTGAGGTTCGTATTGAACAAAAAATTCCTGTGCCTTATTTAACGCATCGAGCGTGGTTTTGTGGACATGAATTTTATGTTGATGAACGTGTTTTGATCCCTCGTTCTCCCATTGGTGAATTGATTAATAACCATTTTGCTGGACTGATTGGGCAAGAGCCAACCCGTATCCTTGATTTATGTACTGGCAGTGGATGTATTGCTATTGCTTGCGCCCATGAATTTCAAGAAGCAGAAGTCGATGCAGTCGATATTTCAGCTGATGCGTTAGAAGTTGCCGAGTTTAATATTGAAAATCATGGTTTAATTCATCGTGTTTATCCAATGCAATCTGATCTCTTTGAGGCAATTGTTCCTACACCATACGATATTATCGTGACGAATCCACCTTACGTTGATGCTGAAGATATGGGTGACTTGCCTGATGAATACCATATTGAACCCGAACTTGCATTGGCTTCTGGTGTGGATGGCTTAGATATCACCAGACAAATTTTGCTAAAAGCACCTGATTATTTAAGCGAAAAAGGCATTCTTGTCTGTGAAGTCGGTAATAGCATGGTGCATCTTATCGAACAATTTCCTGAAGTTCCTTTTACTTGGCTTGAGTTTGAAAAGGGAGGCATTGGTGTCTTTATGTTAACGCGTGAGCAACTTGTCGAATTTTCAGATAGCTTTGCTAGCGATAAACGTTGATGTCAATGTGATGAAACGGTAGATTGTTATGGTTGCAAATAACATATTAA