Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 50.5 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 62.3 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 50.5 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 62.3 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 50.5 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 62.3 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_08500 LHKJJB_08500 50.5 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 62.3 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 50.5 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 62.3 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS05065 F4V73_RS05065 50.3 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS12920 F4V73_RS12920 50.7 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 62.3 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 31.1 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00340 PMI_RS00340 29.7 Proteus mirabilis HI4320 - ferredoxin-like protein
PMI_RS00820 PMI_RS00820 41.2 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS05815 PMI_RS05815 48.7 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 49.5 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18776 3.39e-94 276 60 1 203 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P0AAJ1 1.07e-93 275 59 1 203 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 1.07e-93 275 59 1 203 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83RZ7 1.81e-93 274 59 1 203 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P45003 5.71e-90 265 58 2 206 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RNN7 6.88e-27 105 34 4 177 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q9S1G9 2.83e-26 105 54 0 93 1 serB Selenate reductase subunit beta Thauera selenatis
Q9HR73 5.7e-26 103 30 4 206 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P60069 1.63e-25 103 53 0 93 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
P31076 2.45e-25 100 36 6 190 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7CQM9 5.44e-25 100 37 3 154 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45015 4.46e-24 97 35 4 156 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAK0 2.64e-23 98 31 5 191 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 2.64e-23 98 31 5 191 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 2.64e-23 98 31 5 191 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P0A1I1 2.93e-23 95 34 5 161 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 2.93e-23 95 34 5 161 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
O30080 2.45e-22 92 36 5 147 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q47CW7 3.46e-22 95 43 0 97 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q8GPG3 8.34e-22 94 27 3 211 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
Q83RN5 5.74e-21 93 37 3 148 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P33389 5.76e-21 92 32 6 174 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P11349 5.8e-21 93 37 3 148 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
P19318 8.27e-21 92 46 0 94 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P0AAK9 1.01e-20 89 33 3 155 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 1.01e-20 89 33 3 155 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 1.01e-20 89 33 3 155 3 nrfC Protein NrfC Escherichia coli O157:H7
P42176 1.03e-20 92 43 0 93 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
Q727P4 1.53e-20 88 30 5 171 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P27273 2.6e-20 87 33 5 178 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
I3R9M8 1.18e-19 88 36 5 150 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P85098 1.01e-18 84 32 8 197 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P77375 1.05e-18 84 32 4 154 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 1.88e-18 83 32 4 151 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P56256 1.91e-18 81 32 4 153 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
Q7WTT9 3.34e-18 82 27 4 207 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P0AAJ7 3.99e-18 83 32 4 163 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 3.99e-18 83 32 4 163 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 3.99e-18 83 32 4 163 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAJ4 4.54e-18 83 29 3 160 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 4.54e-18 83 29 3 160 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P44450 1.5e-17 82 28 4 161 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q72E85 3.47e-14 72 28 5 200 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57713 6.47e-14 69 36 6 133 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8GC87 9.96e-14 70 27 9 214 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
O29751 1.19e-13 70 28 8 199 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q46819 2.16e-13 68 29 6 155 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P0AAL8 1.9e-12 66 28 3 151 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 1.9e-12 66 28 3 151 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 1.9e-12 66 28 3 151 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q8L3A9 2.56e-12 68 30 3 143 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
Q46820 1.1e-11 66 27 7 151 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P80564 1.33e-10 62 28 8 188 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
P31894 1.69e-10 61 24 5 166 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P37127 6.18e-10 61 29 6 155 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q57712 8.49e-10 58 38 3 88 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK4 1.09e-09 58 28 9 181 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 1.09e-09 58 28 9 181 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 1.09e-09 58 28 9 181 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P0AAK3 2.03e-09 58 28 3 114 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 2.03e-09 58 28 3 114 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 2.03e-09 58 28 3 114 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P20925 3.13e-09 57 34 6 117 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q57619 4.37e-08 53 28 5 150 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P23481 7.55e-08 53 29 3 101 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P00202 0.000427 40 45 0 46 1 None Ferredoxin Methanosarcina barkeri
Q92G41 0.000542 41 35 1 57 3 fdxA Ferredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08350
Feature type CDS
Gene dmsB
Product dimethylsulfoxide reductase subunit B
Location 1825237 - 1825854 (strand: 1)
Length 618 (nucleotides) / 205 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways		 -

Protein Sequence

MKQYGFYFDSTKCTGCKTCQVSCKDEKDLDLGPKFRRVYEYGGGSWAKQDGIWTQNIYSYYLSISCNHCSNPTCVAGCPTGAMHKREEDGLVVVNQDVCVGCRYCELRCPYGAPQFDEKKKLMSKCDGCYERVAQGMKPVCVESCPQRALDFDDIEVIRAKHGTECGIAPMPDPSLTNPNIVIKAHKDAKPSGDKTGSVQNAAEV

Flanking regions ( +/- flanking 50bp)

CCACAACATACTAACCTTGTTGAAGTGAAACGTGCATAAGGAGTTAACTCATGAAACAATATGGTTTTTATTTTGACTCCACTAAATGCACTGGCTGTAAAACCTGTCAAGTCAGTTGCAAGGACGAAAAAGATTTAGATTTAGGCCCTAAATTCCGTCGTGTTTATGAATATGGCGGTGGTAGCTGGGCAAAACAAGACGGTATCTGGACACAAAATATTTATAGTTATTATTTATCAATTTCTTGTAACCACTGCTCTAACCCTACTTGCGTGGCAGGTTGCCCTACTGGCGCGATGCATAAACGTGAAGAAGACGGTTTAGTGGTTGTTAATCAAGATGTTTGTGTTGGATGCCGTTATTGTGAATTACGCTGCCCTTATGGCGCACCACAGTTTGATGAAAAGAAAAAATTGATGTCAAAATGTGATGGTTGCTATGAGCGTGTCGCCCAAGGTATGAAACCGGTCTGTGTTGAATCTTGTCCACAACGTGCACTGGATTTTGATGATATTGAAGTGATCAGAGCGAAACATGGTACAGAGTGTGGTATCGCACCAATGCCAGATCCAAGCTTAACTAACCCAAATATCGTGATAAAAGCACATAAAGATGCAAAACCTTCTGGTGATAAAACCGGCTCAGTTCAAAATGCGGCGGAGGTATAAACCATGCATGAACTTCCTCTTGTCTTTTTTACTGTTTTAGGCTCTAGCGC