Homologs in group_305

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08170 FBDBKF_08170 29.5 Morganella morganii S1 ilvE branched-chain amino acid transaminase
EHELCC_13355 EHELCC_13355 31.9 Morganella morganii S2 ilvE branched-chain-amino-acid transaminase
NLDBIP_13695 NLDBIP_13695 29.5 Morganella morganii S4 ilvE branched-chain amino acid transaminase
LHKJJB_12860 LHKJJB_12860 29.5 Morganella morganii S3 ilvE branched-chain amino acid transaminase
HKOGLL_12170 HKOGLL_12170 29.5 Morganella morganii S5 ilvE branched-chain amino acid transaminase
F4V73_RS18700 F4V73_RS18700 28.7 Morganella psychrotolerans - branched-chain amino acid transaminase
PMI_RS16410 PMI_RS16410 29.8 Proteus mirabilis HI4320 - branched-chain amino acid transaminase

Distribution of the homologs in the orthogroup group_305

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_305

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P99090 3.35e-60 195 38 3 273 1 dat D-alanine aminotransferase Staphylococcus aureus (strain N315)
P63511 3.35e-60 195 38 3 273 3 dat D-alanine aminotransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
P19938 5.85e-60 195 40 5 271 1 dat D-alanine aminotransferase Bacillus sp. (strain YM-1)
Q5HF24 5.94e-60 195 37 3 273 3 dat D-alanine aminotransferase Staphylococcus aureus (strain COL)
Q6G8H7 7.61e-60 194 37 3 273 3 dat D-alanine aminotransferase Staphylococcus aureus (strain MSSA476)
Q8NW24 1.67e-59 194 37 3 273 3 dat D-alanine aminotransferase Staphylococcus aureus (strain MW2)
Q6GFV1 1.67e-59 194 37 3 273 3 dat D-alanine aminotransferase Staphylococcus aureus (strain MRSA252)
P54694 8.86e-57 187 35 3 271 3 dat D-alanine aminotransferase Staphylococcus haemolyticus
Q8CS41 2.84e-56 185 36 3 271 3 dat D-alanine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNG0 2.84e-56 185 36 3 271 3 dat D-alanine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q71Z49 7.02e-54 179 35 2 277 3 dat D-alanine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
Q92B90 1.01e-51 174 35 2 277 3 dat D-alanine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P54692 8.82e-51 171 34 5 272 3 dat D-alanine aminotransferase Bacillus licheniformis
O07597 2.59e-49 167 34 7 280 3 dat D-alanine aminotransferase Bacillus subtilis (strain 168)
G2JZ74 1.76e-48 166 35 2 277 3 dat D-alanine aminotransferase Listeria monocytogenes serotype 1/2a (strain 10403S)
P0DJL9 1.84e-48 166 35 2 277 3 dat D-alanine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P54693 2.37e-48 165 35 3 273 3 dat D-alanine aminotransferase Lysinibacillus sphaericus
O29329 2.77e-42 149 32 5 277 1 ilvE Putative branched-chain-amino-acid aminotransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q58414 4.01e-40 144 32 7 279 3 ilvE Putative branched-chain-amino-acid aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9ASR4 3.18e-30 122 29 6 280 2 At5g27410 Branched-chain-amino-acid aminotransferase-like protein 2 Arabidopsis thaliana
O67733 8.89e-28 112 27 11 296 3 ilvE Probable branched-chain-amino-acid aminotransferase Aquifex aeolicus (strain VF5)
Q8W0Z7 6.4e-27 112 28 6 289 2 At3g05190 Branched-chain-amino-acid aminotransferase-like protein 1 Arabidopsis thaliana
P0A1A5 2.87e-24 102 26 7 294 1 ilvE Branched-chain-amino-acid aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1A6 2.87e-24 102 26 7 294 3 ilvE Branched-chain-amino-acid aminotransferase Salmonella typhi
P0AB80 6.63e-24 101 25 7 294 1 ilvE Branched-chain-amino-acid aminotransferase Escherichia coli (strain K12)
P0AB81 6.63e-24 101 25 7 294 3 ilvE Branched-chain-amino-acid aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB82 6.63e-24 101 25 7 294 3 ilvE Branched-chain-amino-acid aminotransferase Escherichia coli O157:H7
O27481 9.82e-21 92 27 8 285 3 ilvE Putative branched-chain-amino-acid aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q1RIJ2 1.05e-20 92 26 8 270 3 ilvE Probable branched-chain-amino-acid aminotransferase Rickettsia bellii (strain RML369-C)
Q8L493 1.92e-19 90 26 7 258 1 DAAT D-amino-acid transaminase, chloroplastic Arabidopsis thaliana
O86428 2.64e-19 89 24 7 287 1 ilvE Branched-chain-amino-acid aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4ULR3 8.35e-19 87 25 7 269 3 ilvE Probable branched-chain-amino-acid aminotransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92I26 1.57e-18 86 26 11 288 3 ilvE Probable branched-chain-amino-acid aminotransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P28821 1.13e-17 84 26 5 264 3 pabC Aminodeoxychorismate lyase Bacillus subtilis (strain 168)
O05970 1.7e-15 78 23 7 281 3 ilvE Probable branched-chain-amino-acid aminotransferase Rickettsia prowazekii (strain Madrid E)
Q9AKE5 4.12e-15 77 23 5 262 3 ilvE Probable branched-chain-amino-acid aminotransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P28305 1.02e-14 75 25 6 249 1 pabC Aminodeoxychorismate lyase Escherichia coli (strain K12)
Q8CQ78 4.2e-14 75 27 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRJ8 9.99e-14 73 26 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
K7QHS5 1.83e-13 73 36 5 134 1 BCAT2 Branched-chain amino acid aminotransferase 2, chloroplastic Humulus lupulus
P54691 2.27e-13 72 26 12 294 3 ilvE Probable branched-chain-amino-acid aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P63513 9.19e-13 70 26 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain MW2)
Q6GBT3 9.19e-13 70 26 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain MSSA476)
P99138 9.19e-13 70 26 12 298 1 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain N315)
P63512 9.19e-13 70 26 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIC1 9.19e-13 70 26 12 298 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain COL)
Q6GJB4 6e-12 68 26 12 300 3 ilvE Probable branched-chain-amino-acid aminotransferase Staphylococcus aureus (strain MRSA252)
Q79FW0 6.37e-12 68 22 6 273 1 Rv0812 Bifunctional aminodeoxychorismate lyase / D-amino acid transaminase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9M401 2.77e-11 67 32 5 138 1 BCAT3 Branched-chain-amino-acid aminotransferase 3, chloroplastic Arabidopsis thaliana
Q9FYA6 4.31e-11 66 36 4 114 1 BCAT5 Branched-chain-amino-acid aminotransferase 5, chloroplastic Arabidopsis thaliana
P74921 4.42e-10 62 25 11 263 1 ilvE Probable branched-chain-amino-acid aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9KQI0 2.39e-09 60 20 9 282 3 pabC Aminodeoxychorismate lyase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
K7QKH1 1.14e-08 58 32 3 113 1 BCAT1 Branched-chain amino acid aminotransferase 1, mitochondrial Humulus lupulus
Q9ZJF1 1.52e-08 58 33 4 130 3 ilvE Branched-chain-amino-acid aminotransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q9M439 1.91e-08 58 27 6 170 1 BCAT2 Branched-chain-amino-acid aminotransferase 2, chloroplastic Arabidopsis thaliana
O26004 4.06e-08 57 33 4 130 3 ilvE Branched-chain-amino-acid aminotransferase Helicobacter pylori (strain ATCC 700392 / 26695)
P54690 5.94e-08 57 33 4 116 1 Bcat1 Branched-chain-amino-acid aminotransferase, cytosolic Rattus norvegicus
Q5AV02 7.13e-08 56 25 12 254 2 atnH Branched-chain-amino-acid aminotransferase atnH Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P24288 1.53e-07 55 33 5 116 1 Bcat1 Branched-chain-amino-acid aminotransferase, cytosolic Mus musculus
P39576 1.83e-07 55 27 13 260 1 ilvK Branched-chain-amino-acid aminotransferase 2 Bacillus subtilis (strain 168)
O14370 9.6e-07 53 31 4 116 1 eca39 Branched-chain-amino-acid aminotransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9LPM8 1.48e-06 52 27 4 150 5 BCAT7 Putative branched-chain-amino-acid aminotransferase 7 Arabidopsis thaliana
P9WQ75 1.7e-06 52 27 4 137 1 ilvE Branched-chain-amino-acid aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ74 1.7e-06 52 27 4 137 3 ilvE Branched-chain-amino-acid aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P38891 2.04e-06 52 27 15 249 1 BAT1 Branched-chain-amino-acid aminotransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9GKM4 3.28e-06 51 32 5 116 2 BCAT1 Branched-chain-amino-acid aminotransferase, cytosolic Ovis aries
A7SLW1 5.39e-06 50 29 5 121 3 v1g246094 Branched-chain-amino-acid aminotransferase Nematostella vectensis
P47176 5.57e-06 50 32 6 138 1 BAT2 Branched-chain-amino-acid aminotransferase, cytosolic Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q93Y32 2.58e-05 48 31 4 122 1 BCAT1 Branched-chain-amino-acid aminotransferase 1, mitochondrial Arabidopsis thaliana
A9UZ24 2.61e-05 48 27 6 133 3 37018 Branched-chain-amino-acid aminotransferase Monosiga brevicollis
A0R066 4.24e-05 48 24 13 274 1 ilvE Branched-chain-amino-acid aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O32954 5.27e-05 47 27 5 137 3 ilvE Probable branched-chain-amino-acid aminotransferase Mycobacterium leprae (strain TN)
P54687 5.79e-05 47 30 5 116 1 BCAT1 Branched-chain-amino-acid aminotransferase, cytosolic Homo sapiens
O35855 0.000104 47 25 11 234 1 Bcat2 Branched-chain-amino-acid aminotransferase, mitochondrial Mus musculus
Q9LPM9 0.000173 46 23 8 215 1 BCAT6 Branched-chain-amino-acid aminotransferase 6 Arabidopsis thaliana
P54689 0.000244 45 30 8 152 3 ilvE Branched-chain-amino-acid aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5EA40 0.000268 45 28 5 122 2 BCAT2 Branched-chain-amino-acid aminotransferase, mitochondrial Bos taurus
Q5REP0 0.000676 44 27 4 109 2 BCAT2 Branched-chain-amino-acid aminotransferase, mitochondrial Pongo abelii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08325
Feature type CDS
Gene -
Product D-amino-acid transaminase
Location 1817238 - 1818095 (strand: -1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_305
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01063 Amino-transferase class IV

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0115 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase

Kegg Ortholog Annotation(s)

Protein Sequence

MSEIVYLNNQFVPKEQANISVFDRGFLFADAVYEVTAVINGQLIDFEGHFQRLQRSCKALSMPFSLTKEQLKEIHRQLIDKNHLHEGLIYLQVTRGADSSRFFDFPSSLVAPTLVLFVQHSTVVNHPNASKGISVVSVEDIRWQRCDIKTVALLAACLAKHHAHQQGADDAIFIKEGYITEGSSSNFFIVNQQDEIITRPLSQDILPGITRQAIIQLAKEQKLTIIERLFTLEEAKQAKEAFISSATTLIWPVISIDNEKINQGKVGALSQRLREIYLEKAGVKP

Flanking regions ( +/- flanking 50bp)

TAGTGTGGTGAAAAGTTATCAAGGTTAATACAATTTATCACGGAGGTAAAATGTCTGAGATTGTGTATTTAAATAACCAATTTGTACCTAAAGAACAAGCTAATATCTCTGTTTTTGATCGAGGTTTCTTATTTGCTGATGCCGTTTACGAAGTTACTGCCGTTATTAACGGGCAATTAATTGATTTTGAAGGGCATTTTCAACGTTTACAGCGCTCTTGTAAAGCATTATCAATGCCTTTTTCACTAACAAAAGAGCAATTAAAAGAGATCCACAGGCAATTAATTGATAAGAACCATCTACATGAAGGACTTATCTATTTACAAGTTACTCGTGGCGCCGATTCATCACGTTTTTTTGATTTTCCGTCTTCATTAGTCGCCCCTACACTCGTGCTATTTGTTCAACACTCAACGGTGGTAAATCATCCTAATGCAAGCAAAGGGATTTCTGTCGTAAGTGTTGAAGATATTCGTTGGCAACGCTGTGATATTAAAACGGTGGCATTACTTGCTGCTTGTTTAGCAAAACATCATGCGCATCAGCAAGGTGCTGATGATGCTATTTTTATCAAAGAGGGTTATATCACCGAAGGGAGTTCAAGTAATTTCTTTATTGTTAATCAGCAAGATGAAATTATCACTCGTCCATTAAGCCAAGATATTTTACCGGGGATCACGCGACAAGCGATTATTCAGTTAGCCAAAGAACAAAAACTCACCATCATTGAGCGTTTATTTACACTTGAAGAAGCGAAACAAGCCAAAGAGGCTTTTATTAGTTCAGCGACCACTTTAATTTGGCCGGTGATCTCCATTGATAATGAAAAAATAAATCAAGGTAAGGTAGGGGCGTTATCACAACGCTTAAGAGAAATTTATCTTGAGAAAGCTGGTGTTAAACCATAGTGAATTGTTATTGCACTGATTTTGACGTTATCCGAAAAATCAGTGCGATA