Homologs in group_0

Help

30 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00180 FBDBKF_00180 78.6 Morganella morganii S1 cspC Cold shock protein, CspA family
FBDBKF_00840 FBDBKF_00840 94.3 Morganella morganii S1 cspE transcription antiterminator/RNA stability regulator CspE
FBDBKF_10120 FBDBKF_10120 78.3 Morganella morganii S1 cspE transcription antiterminator/RNA stability regulator CspE
FBDBKF_12525 FBDBKF_12525 78.6 Morganella morganii S1 cspC Cold shock protein, CspA family
FBDBKF_16430 FBDBKF_16430 79.7 Morganella morganii S1 cspE transcription antiterminator/RNA stability regulator CspE
EHELCC_00705 EHELCC_00705 94.3 Morganella morganii S2 cspE transcription antiterminator/RNA stability regulator CspE
EHELCC_01365 EHELCC_01365 78.6 Morganella morganii S2 cspC Cold shock protein, CspA family
EHELCC_04920 EHELCC_04920 78.3 Morganella morganii S2 cspE transcription antiterminator/RNA stability regulator CspE
EHELCC_08295 EHELCC_08295 79.7 Morganella morganii S2 cspE transcription antiterminator/RNA stability regulator CspE
NLDBIP_02095 NLDBIP_02095 78.6 Morganella morganii S4 cspC Cold shock protein, CspA family
NLDBIP_02755 NLDBIP_02755 94.3 Morganella morganii S4 cspE transcription antiterminator/RNA stability regulator CspE
NLDBIP_04920 NLDBIP_04920 78.3 Morganella morganii S4 cspE transcription antiterminator/RNA stability regulator CspE
NLDBIP_08620 NLDBIP_08620 79.7 Morganella morganii S4 cspE transcription antiterminator/RNA stability regulator CspE
LHKJJB_03610 LHKJJB_03610 78.6 Morganella morganii S3 cspC Cold shock protein, CspA family
LHKJJB_04270 LHKJJB_04270 94.3 Morganella morganii S3 cspE transcription antiterminator/RNA stability regulator CspE
LHKJJB_05645 LHKJJB_05645 79.7 Morganella morganii S3 cspE transcription antiterminator/RNA stability regulator CspE
LHKJJB_13710 LHKJJB_13710 78.3 Morganella morganii S3 cspE transcription antiterminator/RNA stability regulator CspE
HKOGLL_02775 HKOGLL_02775 94.3 Morganella morganii S5 cspE transcription antiterminator/RNA stability regulator CspE
HKOGLL_03435 HKOGLL_03435 78.6 Morganella morganii S5 cspC Cold shock protein, CspA family
HKOGLL_05270 HKOGLL_05270 79.7 Morganella morganii S5 cspE transcription antiterminator/RNA stability regulator CspE
HKOGLL_12825 HKOGLL_12825 78.3 Morganella morganii S5 cspE transcription antiterminator/RNA stability regulator CspE
F4V73_RS00215 F4V73_RS00215 78.3 Morganella psychrotolerans cspE transcription antiterminator/RNA stability regulator CspE
F4V73_RS02950 F4V73_RS02950 79.7 Morganella psychrotolerans cspE transcription antiterminator/RNA stability regulator CspE
F4V73_RS06830 F4V73_RS06830 94.3 Morganella psychrotolerans cspE transcription antiterminator/RNA stability regulator CspE
F4V73_RS07335 F4V73_RS07335 72.9 Morganella psychrotolerans cspA RNA chaperone/antiterminator CspA
F4V73_RS07755 F4V73_RS07755 77.1 Morganella psychrotolerans - cold-shock protein
PMI_RS02060 PMI_RS02060 78.3 Proteus mirabilis HI4320 cspE transcription antiterminator/RNA stability regulator CspE
PMI_RS03965 PMI_RS03965 75.7 Proteus mirabilis HI4320 - cold-shock protein
PMI_RS04480 PMI_RS04480 72.9 Proteus mirabilis HI4320 - cold-shock protein
PMI_RS04745 PMI_RS04745 78.6 Proteus mirabilis HI4320 cspA RNA chaperone/antiterminator CspA

Distribution of the homologs in the orthogroup group_0

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_0

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9Y9 1.64e-38 124 89 0 67 3 cspC Cold shock-like protein CspC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Z0 1.64e-38 124 89 0 67 3 cspC Cold shock-like protein CspC Salmonella typhi
E0J500 1.64e-38 124 89 0 67 1 cspC Cold shock-like protein CspC Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0A9Y6 1.64e-38 124 89 0 67 1 cspC Cold shock-like protein CspC Escherichia coli (strain K12)
P0A9Y7 1.64e-38 124 89 0 67 3 cspC Cold shock-like protein CspC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Y8 1.64e-38 124 89 0 67 3 cspC Cold shock-like protein CspC Escherichia coli O157:H7
Q83RI9 6.98e-38 123 88 0 67 3 cspC Cold shock-like protein CspC Shigella flexneri
P57407 5.06e-36 118 83 0 67 3 cspC Cold shock-like protein CspC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P0A975 6.73e-36 118 86 0 67 3 cspE Cold shock-like protein CspE Shigella flexneri
E0J1Q3 6.73e-36 118 86 0 67 1 cspE Cold shock-like protein CspE Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0A972 6.73e-36 118 86 0 67 1 cspE Cold shock-like protein CspE Escherichia coli (strain K12)
P0A973 6.73e-36 118 86 0 67 3 cspE Cold shock-like protein CspE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A974 6.73e-36 118 86 0 67 3 cspE Cold shock-like protein CspE Escherichia coli O157:H7
P63238 5.48e-35 115 83 0 67 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P63237 5.48e-35 115 83 0 67 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89A90 1.26e-34 115 82 0 67 3 cspE Cold shock-like protein CspE Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P0A362 4.2e-34 113 77 0 70 3 cspB Cold shock-like protein CspB Yersinia pestis
P0A363 4.2e-34 113 77 0 70 3 cspB Cold shock-like protein CspB Yersinia enterocolitica
P0A9Y4 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Shigella flexneri
P0A9Y2 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Y3 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Salmonella typhi
P0A9Y5 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Salmonella enteritidis
Q46664 4.26e-33 111 77 0 70 3 cspA Major cold shock protein Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P0A9X9 4.26e-33 111 77 0 70 1 cspA Cold shock protein CspA Escherichia coli (strain K12)
P0A9Y0 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Y1 4.26e-33 111 77 0 70 3 cspA Cold shock protein CspA Escherichia coli O157:H7
P0A986 1.18e-32 110 77 0 70 3 cspI Cold shock-like protein CspI Escherichia coli (strain K12)
P0A987 1.18e-32 110 77 0 70 3 cspI Cold shock-like protein CspI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A981 9.96e-32 107 72 0 70 3 cspG Cold shock-like protein CspG Shigella flexneri
P0A978 9.96e-32 107 72 0 70 1 cspG Cold shock-like protein CspG Escherichia coli (strain K12)
P0A979 9.96e-32 107 72 0 70 3 cspG Cold shock-like protein CspG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A980 9.96e-32 107 72 0 70 3 cspG Cold shock-like protein CspG Escherichia coli O157:H7
P36995 4.04e-31 106 74 0 67 1 cspB Cold shock-like protein CspB Escherichia coli (strain K12)
P0CL01 1.15e-30 105 70 0 70 3 cspJ Cold shock-like protein CspJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WGN1 1.15e-30 105 70 0 70 2 cspJ Cold shock-like protein CspJ Salmonella typhimurium (strain SL1344)
P58726 6.75e-30 103 70 0 70 3 cspJ Cold shock-like protein CspJ Salmonella typhi
Q9KN00 5.31e-29 100 68 0 70 3 cspA Cold shock-like protein CspA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KL16 8.9e-29 100 67 0 70 2 cspV Cold shock protein CspV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9S170 2.6e-25 91 64 0 70 2 cspG Cold shock-like protein CspG Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
P62171 5.54e-25 90 66 1 66 3 cspC Cold shock-like protein CspC Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P62170 5.54e-25 90 66 1 66 4 cspC Cold shock-like protein CspC Bacillus cereus
P62169 5.54e-25 90 66 1 66 3 cspC Cold shock-like protein CspC Bacillus anthracis
O30875 5.72e-24 88 67 0 64 3 cspA Major cold shock protein Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q9S1B7 6.68e-24 88 62 0 70 2 cspA Cold shock-like protein CspA Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
P9WP75 3.99e-23 85 61 0 65 1 cspA Probable cold shock protein A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP74 3.99e-23 85 61 0 65 3 cspA Probable cold shock protein A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63849 3.99e-23 85 61 0 65 3 cspA Probable cold shock protein A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P32081 5.48e-23 85 67 1 64 1 cspB Cold shock protein CspB Bacillus subtilis (strain 168)
Q81DK5 7.13e-23 85 63 1 66 3 cspE Cold shock-like protein CspE Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q45099 1.26e-22 84 69 1 62 1 cspD Cold shock-like protein CspD Bacillus cereus
Q816H3 1.39e-22 84 69 1 62 3 cspD Cold shock-like protein CspD Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81K90 1.39e-22 84 69 1 62 3 cspD Cold shock-like protein CspD Bacillus anthracis
Q45097 1.48e-22 84 63 1 66 4 cspB Cold shock-like protein CspB Bacillus cereus
P0DA49 1.54e-22 84 63 1 65 3 cspA Major cold shock protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0A361 1.54e-22 84 63 1 65 3 cspA Major cold shock protein Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DA48 1.54e-22 84 63 1 65 3 cspA Major cold shock protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0F1 1.54e-22 84 63 1 65 3 cspA Major cold shock protein Streptococcus pyogenes serotype M1
A0R5E1 3.07e-22 83 58 0 65 1 cspA Probable cold shock protein A Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P41016 3.09e-22 83 63 1 65 1 cspB Cold shock protein CspB Bacillus caldolyticus
P95459 4.35e-22 83 57 1 70 2 cspA Major cold shock protein CspA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A357 5.47e-22 83 65 1 64 3 cspLB Cold shock-like protein CspLB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A358 5.47e-22 83 65 1 64 3 cspLB Cold shock-like protein CspLB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q56922 5.53e-22 82 88 0 45 3 cspA Major cold shock protein (Fragment) Yersinia enterocolitica
O54310 7.43e-22 82 60 1 66 1 csp Cold shock-like protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q81QK2 7.55e-22 82 60 1 66 3 cspE Cold shock-like protein CspE Bacillus anthracis
Q5X9L4 7.97e-22 82 61 1 65 3 cspA Major cold shock protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P42016 9.36e-22 82 61 1 65 2 cspB Cold shock protein CspB Geobacillus stearothermophilus
P0A355 1.18e-21 82 66 1 62 1 cspLA Cold shock-like protein CspLA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A356 1.18e-21 82 66 1 62 3 cspLA Cold shock-like protein CspLA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q45096 1.78e-21 81 62 1 66 1 cspA Major cold shock protein CspA Bacillus cereus
P54584 2.88e-21 81 61 0 65 2 csp Cold shock protein Arthrobacter globiformis
Q81GQ6 3.18e-21 81 62 1 66 3 cspA Major cold shock protein CspA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TW8 3.18e-21 81 62 1 66 3 cspA Major cold shock protein CspA Bacillus anthracis
P72188 3.83e-21 80 59 0 64 2 capA Cold shock protein CapA (Fragment) Pseudomonas fragi
P96349 5.3e-21 80 67 1 61 2 cspL Cold shock protein 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P39158 7.44e-21 80 64 1 62 1 cspC Cold shock protein CspC Bacillus subtilis (strain 168)
O67327 9.21e-21 80 56 0 65 3 csp Cold shock-like protein Aquifex aeolicus (strain VF5)
P0A105 1.12e-20 79 55 1 70 3 capB Cold shock protein CapB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P0A106 1.12e-20 79 55 1 70 1 capB Cold shock protein CapB Pseudomonas fragi
P71478 1.14e-20 79 67 1 61 2 csp Cold shock protein 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4L6A7 1.21e-20 79 60 1 65 3 cspA Cold shock protein CspA Staphylococcus haemolyticus (strain JCSC1435)
Q48493 1.61e-20 79 82 0 46 3 cspA Major cold shock protein (Fragment) Klebsiella pneumoniae
P72192 1.64e-20 79 62 1 64 2 tapB Temperature acclimation protein B (Fragment) Pseudomonas fragi
P51777 1.73e-20 79 59 1 64 1 cspD Cold shock protein CspD Bacillus subtilis (strain 168)
Q49XK3 2.16e-20 79 60 1 65 3 cspA Cold shock protein CspA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CP90 2.16e-20 79 60 1 65 3 cspA Cold shock protein CspA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPE0 2.16e-20 79 60 1 65 3 cspA Cold shock protein CspA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A352 2.79e-20 79 57 0 64 3 cspA Cold shock-like protein CspA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A354 2.79e-20 79 57 0 64 3 cspA Cold shock-like protein CspA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A353 2.79e-20 79 57 0 64 3 cspA Cold shock-like protein CspA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7A0X3 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MW2)
Q6G9F9 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MSSA476)
Q6GH06 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain MRSA252)
Q7A5P3 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain N315)
Q7A2R8 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG18 2.96e-20 78 60 1 65 1 cspA Cold shock protein CspA Staphylococcus aureus (strain COL)
Q2YY16 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FYN2 2.96e-20 78 60 1 65 1 cspA Cold shock protein CspA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH36 2.96e-20 78 60 1 65 3 cspA Cold shock protein CspA Staphylococcus aureus (strain USA300)
Q44317 5.21e-20 77 82 0 45 3 cspA Major cold-shock protein (Fragment) Aeromonas salmonicida
P72366 1.05e-19 77 57 0 64 3 cspA Cold shock-like protein CspA Stigmatella aurantiaca (strain DW4/3-1)
Q44078 1.51e-19 76 82 0 45 3 cspA Major cold-shock protein (Fragment) Aeromonas hydrophila
Q53816 1.53e-19 76 80 0 45 3 cspA Major cold shock protein (Fragment) Shigella boydii
Q56178 1.53e-19 76 80 0 45 3 cspA Major cold shock protein (Fragment) Salmonella virchow
Q46051 1.53e-19 76 80 0 45 3 cspA Major cold shock protein (Fragment) Citrobacter freundii
P41018 3.52e-19 75 65 1 58 3 cspB Cold shock protein CspB (Fragment) Sporosarcina globispora
Q45100 1.59e-18 73 67 1 53 1 cspE Cold shock-like protein CspE (Fragment) Bacillus cereus
P0A971 1.73e-18 74 49 0 65 3 cspD Cold shock-like protein CspD Shigella flexneri
P0A968 1.73e-18 74 49 0 65 1 cspD Cold shock-like protein CspD Escherichia coli (strain K12)
P0A969 1.73e-18 74 49 0 65 3 cspD Cold shock-like protein CspD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A970 1.73e-18 74 49 0 65 3 cspD Cold shock-like protein CspD Escherichia coli O157:H7
Q9KSW4 2.17e-17 71 45 0 70 3 cspD Cold shock-like protein CspD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P48859 2.42e-17 71 54 0 62 2 scoF Cold shock protein ScoF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P27484 5.47e-17 74 56 0 62 2 GRP-2 Glycine-rich protein 2 Nicotiana sylvestris
Q38896 9.31e-17 73 52 1 67 1 CSP4 Cold shock domain-containing protein 4 Arabidopsis thaliana
P0A1D9 3.28e-16 68 52 0 67 3 cspH Cold shock-like protein CspH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E0 3.28e-16 68 52 0 67 3 cspH Cold shock-like protein CspH Salmonella typhi
P72191 4.27e-16 68 62 1 58 2 tapA Temperature acclimation protein A (Fragment) Pseudomonas fragi
Q9Z3S6 5.65e-16 67 55 0 54 2 cspA Cold shock protein CspA Rhizobium meliloti (strain 1021)
Q9VRN5 1.21e-15 70 47 0 63 2 lin-28 Protein lin-28 homolog Drosophila melanogaster
Q01761 1.36e-15 67 54 1 62 1 SC7.0 Cold shock-like protein 7.0 Streptomyces clavuligerus
P0A985 3.27e-15 66 50 0 67 3 cspH Cold shock-like protein CspH Shigella flexneri
P0A982 3.27e-15 66 50 0 67 3 cspH Cold shock-like protein CspH Escherichia coli (strain K12)
P0A983 3.27e-15 66 50 0 67 3 cspH Cold shock-like protein CspH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A984 3.27e-15 66 50 0 67 3 cspH Cold shock-like protein CspH Escherichia coli O157:H7
P55390 3.33e-15 65 55 0 49 4 NGR_a00060 Probable cold shock protein y4cH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZCP9 5e-14 63 47 0 67 3 cspA Cold shock-like protein CspA Rickettsia prowazekii (strain Madrid E)
P0A976 6.43e-14 62 47 0 67 3 cspF Cold shock-like protein CspF Escherichia coli (strain K12)
P0A977 6.43e-14 62 47 0 67 3 cspF Cold shock-like protein CspF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q94C69 6.92e-14 67 48 1 64 1 CSP3 Cold shock domain-containing protein 3 Arabidopsis thaliana
O65639 9.26e-14 66 54 1 64 1 CSP1 Cold shock protein 1 Arabidopsis thaliana
Q92GV1 1.04e-13 62 44 0 67 3 cspA Cold shock-like protein CspA Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RHK6 1.6e-13 61 46 0 67 3 cspA Cold shock-like protein CspA Rickettsia bellii (strain RML369-C)
Q52287 1.72e-13 61 65 0 46 3 cspA Major cold shock protein (Fragment) Photobacterium phosphoreum
Q53984 2.03e-13 60 65 1 46 3 cspA Major cold shock protein (Fragment) Streptococcus dysgalactiae
Q4UMU5 2.14e-13 61 44 0 67 3 cspA Cold shock-like protein CspA Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68W69 2.47e-13 61 46 0 67 3 cspA Cold shock-like protein CspA Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P46449 2.8e-13 61 40 0 64 3 cspD Cold shock-like protein CspD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q51929 1.98e-12 58 62 0 45 3 cspA Major cold shock protein (Fragment) Photobacterium leiognathi subsp. mandapamensis
P0C0F0 2.44e-12 58 63 1 46 3 cspA Major cold shock protein (Fragment) Streptococcus pyogenes
P45441 4.74e-12 62 43 1 72 1 ybx2-b Y-box-binding protein 2-B Xenopus laevis
Q41188 6.56e-12 60 58 0 43 1 CSP2 Cold shock protein 2 Arabidopsis thaliana
P16989 6.96e-12 61 44 1 72 1 YBX3 Y-box-binding protein 3 Homo sapiens
Q62764 8.12e-12 61 44 1 72 1 Ybx3 Y-box-binding protein 3 Rattus norvegicus
P21574 1.1e-11 61 43 1 72 1 ybx2-a Y-box-binding protein 2-A Xenopus laevis
P41824 1.15e-11 60 42 1 73 2 None Y-box factor homolog Aplysia californica
Q9JKB3 1.22e-11 60 43 1 73 1 Ybx3 Y-box-binding protein 3 Mus musculus
Q00436 1.33e-11 60 44 1 72 2 None B box-binding protein Xenopus laevis
P21573 1.45e-11 60 46 1 69 2 ybx1 Y-box-binding protein 1 Xenopus laevis
B5DE31 1.53e-11 60 43 1 73 1 ybx1 Y-box-binding protein 1 Danio rerio
Q28618 1.91e-11 60 44 1 72 1 YBX1 Y-box-binding protein 1 Oryctolagus cuniculus
P67809 1.91e-11 60 44 1 72 1 YBX1 Y-box-binding protein 1 Homo sapiens
P67808 1.91e-11 60 44 1 72 2 YBX1 Y-box-binding protein 1 Bos taurus
P62961 1.92e-11 60 44 1 72 2 Ybx1 Y-box-binding protein 1 Rattus norvegicus
P62960 1.92e-11 60 44 1 72 1 Ybx1 Y-box-binding protein 1 Mus musculus
Q06066 2.07e-11 60 44 1 72 2 YBX1 Y-box-binding protein 1 Gallus gallus
Q9Z2C8 4.87e-11 59 46 1 66 1 Ybx2 Y-box-binding protein 2 Mus musculus
Q9Y2T7 8.07e-11 58 44 1 67 1 YBX2 Y-box-binding protein 2 Homo sapiens
Q8AVK2 4.54e-10 56 42 1 70 2 lin28b Protein lin-28 homolog B (Fragment) Xenopus laevis
Q45KJ4 6.21e-10 55 42 1 70 2 LIN28B Protein lin-28 homolog B Gallus gallus
Q5EB47 7.4e-10 55 43 2 69 2 lin28a Protein lin-28 homolog A Xenopus tropicalis
Q6ZN17 7.61e-10 55 44 1 70 1 LIN28B Protein lin-28 homolog B Homo sapiens
Q8JHC4 7.64e-10 55 43 2 69 2 lin28a Protein lin-28 homolog A Xenopus laevis
Q45KJ6 8.44e-10 55 44 1 70 1 Lin28b Protein lin-28 homolog B Mus musculus
Q9H9Z2 9.07e-10 55 43 1 69 1 LIN28A Protein lin-28 homolog A Homo sapiens
Q8K3Y3 1.14e-09 54 43 1 69 1 Lin28a Protein lin-28 homolog A Mus musculus
Q45KJ5 2.19e-09 53 42 1 69 2 LIN28A Protein lin-28 homolog A Gallus gallus
Q803L0 2.54e-09 53 42 1 69 1 lin28a Protein lin-28 homolog A Danio rerio
P91599 2.57e-09 53 41 0 55 2 lin-28 Protein lin-28 Caenorhabditis remanei
P92186 4.13e-09 53 41 0 55 1 lin-28 Protein lin-28 Caenorhabditis elegans
Q61CX7 4.38e-09 53 41 0 55 3 lin-28 Protein lin-28 Caenorhabditis briggsae
Q9WU49 7e-08 49 47 1 48 1 Carhsp1 Calcium-regulated heat stable protein 1 Rattus norvegicus
Q9Y2V2 7.78e-08 48 47 1 48 1 CARHSP1 Calcium-regulated heat-stable protein 1 Homo sapiens
Q9CR86 7.98e-08 48 47 1 48 1 Carhsp1 Calcium-regulated heat stable protein 1 Mus musculus
Q91YQ3 3.09e-07 47 48 1 50 1 Csdc2 Cold shock domain-containing protein C2 Mus musculus
Q63430 8.84e-07 46 46 1 50 1 Csdc2 Cold shock domain-containing protein C2 Rattus norvegicus
Q9Y534 9e-07 46 46 1 50 1 CSDC2 Cold shock domain-containing protein C2 Homo sapiens
Q9VVA0 2.09e-05 42 57 0 33 1 CG9705 Cold shock domain-containing protein CG9705 Drosophila melanogaster
O75534 0.00037 40 38 1 55 1 CSDE1 Cold shock domain-containing protein E1 Homo sapiens
P18395 0.000373 40 38 1 55 2 Csde1 Cold shock domain-containing protein E1 Rattus norvegicus
Q91W50 0.000381 40 38 1 55 1 Csde1 Cold shock domain-containing protein E1 Mus musculus
B7Z0E2 0.000525 39 47 2 53 1 Unr RNA-binding protein Unr Drosophila melanogaster

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08180
Feature type CDS
Gene cspE
Product transcription antiterminator/RNA stability regulator CspE
Location 1789840 - 1790052 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_0
Orthogroup size 31
N. genomes 7

Actions

Genomic region

Domains

PF00313 'Cold-shock' DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1278 Transcription (K) K Cold shock protein, CspA family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03704 cold shock protein - -

Protein Sequence

MSDKMKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFTIENGAKGPAAANVTAL

Flanking regions ( +/- flanking 50bp)

GCCAGTAGATGCCGAGAAGGCAACGTTTTATTGATATATAGGAAAGTCACATGTCTGACAAAATGAAAGGTCAAGTTAAGTGGTTCAACGAGTCTAAAGGCTTTGGTTTTATTACTCCAGCAGACGGAAGCAAAGACGTATTCGTTCACTTTTCTGCCATTCAAGGTAACGGTTTCAAAACTCTGGCTGAAGGTCAGAACGTAGAATTCACAATTGAAAACGGTGCAAAAGGTCCAGCAGCTGCTAACGTAACAGCTCTGTAATAAAAGCCTTTTAAAAATTTTCTTCAAGCCTGTCACCTTCTGGTGGCAGG