Homologs in group_2093

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15755 FBDBKF_15755 64.7 Morganella morganii S1 nfnB Nitroreductase
EHELCC_17670 EHELCC_17670 64.7 Morganella morganii S2 nfnB Nitroreductase
NLDBIP_19340 NLDBIP_19340 64.7 Morganella morganii S4 nfnB Nitroreductase
LHKJJB_18110 LHKJJB_18110 64.7 Morganella morganii S3 nfnB Nitroreductase
HKOGLL_18970 HKOGLL_18970 64.7 Morganella morganii S5 nfnB Nitroreductase
F4V73_RS07935 F4V73_RS07935 66.7 Morganella psychrotolerans - nitroreductase family protein

Distribution of the homologs in the orthogroup group_2093

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2093

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q55233 3.64e-51 167 44 1 178 1 drgA Protein DrgA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P81102 1.15e-24 99 28 4 202 1 yodC Putative NAD(P)H nitroreductase YodC Bacillus subtilis (strain 168)
P96692 1.47e-24 98 31 3 180 1 mhqN Putative NAD(P)H nitroreductase MhqN Bacillus subtilis (strain 168)
P96707 2.56e-24 98 32 6 184 3 ydgI Putative NAD(P)H nitroreductase YdgI Bacillus subtilis (strain 168)
P0DX42 1.56e-15 75 26 6 194 1 cla-er CLA biosynthesis enone reductase Lactiplantibacillus plantarum
Q4L920 7.17e-15 73 26 7 197 3 SH0546 Putative NAD(P)H nitroreductase SH0546 Staphylococcus haemolyticus (strain JCSC1435)
Q60049 6.51e-13 67 27 6 214 1 nox NADH dehydrogenase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5HLA1 7.72e-12 65 25 5 203 3 SERP2086 Putative NAD(P)H nitroreductase SERP2086 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN23 3.41e-11 63 24 5 203 3 SE_2073 Putative NAD(P)H nitroreductase SE_2073 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2FVA4 5.3e-11 62 26 5 198 1 SAOUHSC_02829 Putative NAD(P)H nitroreductase SAOUHSC_02829 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HD30 5.3e-11 62 26 5 198 3 SACOL2534 Putative NAD(P)H nitroreductase SACOL2534 Staphylococcus aureus (strain COL)
Q2FDY2 5.3e-11 62 26 5 198 3 SAUSA300_2462 Putative NAD(P)H nitroreductase SAUSA300_2462 Staphylococcus aureus (strain USA300)
Q4A087 5.47e-11 62 25 6 197 3 SSP0379 Putative NAD(P)H nitroreductase SSP0379 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q99RB2 1.12e-10 62 26 5 198 3 SAV2523 Putative NAD(P)H nitroreductase SAV2523 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q79ZZ6 1.12e-10 62 26 5 198 3 MW2443 Putative NAD(P)H nitroreductase MW2443 Staphylococcus aureus (strain MW2)
Q6G6F2 1.12e-10 62 26 5 198 3 SAS2409 Putative NAD(P)H nitroreductase SAS2409 Staphylococcus aureus (strain MSSA476)
Q2YW87 1.12e-10 62 26 5 198 3 SAB2397c Putative NAD(P)H nitroreductase SAB2397c Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3H8 1.12e-10 62 26 5 198 1 SA2311 Putative NAD(P)H nitroreductase SA2311 Staphylococcus aureus (strain N315)
O34475 7.02e-10 59 22 6 209 1 yfkO Putative NAD(P)H nitroreductase YfkO Bacillus subtilis (strain 168)
Q9FBN0 2.27e-09 58 25 6 176 3 SCO5049 Putative NADH dehydrogenase/NAD(P)H nitroreductase SCO5049 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B1W2E1 1.8e-08 55 25 7 176 3 SGR_2476 Putative NADH dehydrogenase/NAD(P)H nitroreductase SGR_2476 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A6T798 7.41e-08 53 24 3 165 3 rutE Probable malonic semialdehyde reductase RutE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B9K712 2.37e-07 52 24 5 179 1 IYD Iodotyrosine deiodinase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q01234 1.2e-06 50 23 7 189 1 nfsB Oxygen-insensitive NAD(P)H nitroreductase Enterobacter cloacae
B5XXN4 1.42e-06 50 32 1 85 3 rutE Probable malonic semialdehyde reductase RutE Klebsiella pneumoniae (strain 342)
P38489 1.46e-06 50 25 9 199 1 nfsB Oxygen-insensitive NAD(P)H nitroreductase Escherichia coli (strain K12)
B1IV89 7.71e-06 48 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYW3 7.71e-06 48 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O9:H4 (strain HS)
B5YU50 7.71e-06 48 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAU9 7.71e-06 48 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O157:H7
B7M8Z3 8.41e-06 48 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O8 (strain IAI1)
Q32HQ3 9.27e-06 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Shigella dysenteriae serotype 1 (strain Sd197)
Q8FJ44 1.58e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A4W921 1.61e-05 47 23 4 167 3 rutE Probable malonic semialdehyde reductase RutE Enterobacter sp. (strain 638)
Q0TJ59 1.71e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MTF1 1.71e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O81 (strain ED1a)
B7UNZ1 1.85e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RDK9 1.9e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain UTI89 / UPEC)
A1A9R3 1.9e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O1:K1 / APEC
B7MIF5 1.9e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O45:K1 (strain S88 / ExPEC)
B7N3G4 1.92e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NLB8 1.92e-05 47 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3Z3A5 2.62e-05 46 23 5 167 3 rutE Probable malonic semialdehyde reductase RutE Shigella sonnei (strain Ss046)
Q83RV4 2.65e-05 46 23 5 167 3 rutE Probable malonic semialdehyde reductase RutE Shigella flexneri
Q0T626 2.65e-05 46 23 5 167 3 rutE Probable malonic semialdehyde reductase RutE Shigella flexneri serotype 5b (strain 8401)
B6I984 3.24e-05 46 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain SE11)
B7LFB8 3.24e-05 46 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain 55989 / EAEC)
A7ZKB3 3.24e-05 46 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LIZ7 3.75e-05 46 23 4 165 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain SMS-3-5 / SECEC)
O25608 4.08e-05 46 26 8 185 1 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CSR7 6.91e-05 45 27 10 198 3 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain HPAG1)
B4SHM0 0.000106 44 34 2 83 3 Smal_0358 Putative NADH dehydrogenase/NAD(P)H nitroreductase Smal_0358 Stenotrophomonas maltophilia (strain R551-3)
P75894 0.00011 44 23 5 167 1 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain K12)
B1X9C9 0.00011 44 23 5 167 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain K12 / DH10B)
C4ZQD6 0.00011 44 23 5 167 3 rutE Probable malonic semialdehyde reductase RutE Escherichia coli (strain K12 / MC4100 / BW2952)
Q5GUV2 0.000117 44 24 5 189 3 XOO4267 Putative NADH dehydrogenase/NAD(P)H nitroreductase XOO4267 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q9ZKP7 0.000145 44 26 8 183 3 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain J99 / ATCC 700824)
Q2NY49 0.000149 44 24 5 189 3 XOO4023 Putative NADH dehydrogenase/NAD(P)H nitroreductase XOO4023 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2FKV6 0.000167 44 34 2 83 3 Smlt0482 Putative NADH dehydrogenase/NAD(P)H nitroreductase Smlt0482 Stenotrophomonas maltophilia (strain K279a)
A7MFX7 0.000169 44 31 1 85 3 rutE Probable malonic semialdehyde reductase RutE Cronobacter sakazakii (strain ATCC BAA-894)
O26223 0.000236 43 27 6 113 3 MTH_120 Putative NADH dehydrogenase/NAD(P)H nitroreductase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A1JMW8 0.000471 43 28 1 85 3 rutE Probable malonic semialdehyde reductase RutE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P94424 0.001 42 27 3 86 1 nfrA2 FMN reductase [NAD(P)H] Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07410
Feature type CDS
Gene -
Product nitroreductase family protein
Location 1617434 - 1618039 (strand: -1)
Length 606 (nucleotides) / 201 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2093
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00881 Nitroreductase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0778 Energy production and conversion (C) C Nitroreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15976 putative NAD(P)H nitroreductase [EC:1.-.-.-] - -

Protein Sequence

MNVIDAVKNRRATKQFDADFKIPQEEKKALLEDALQYTPSAFNLQHWRLLVVDDVKQRQALRKVGWDQPQITDSAMLIVLCADLNVWESEVKTIWQDANPEVRDIMCSAVDSYYRNKPQVQRDEIMRSAGLFAQTLMLLAQERGFDSCPMDGFDFAEVAKTINLPDHYAICLMIAIGKGKGKPFPRLGKLSFDKAVTFDHF

Flanking regions ( +/- flanking 50bp)

TTCTATAATAGATAAATAAATGTCAATGATTAGCAAATGGATGGAAAATAATGAATGTAATTGATGCAGTAAAAAACCGTCGTGCAACAAAACAGTTTGATGCTGATTTCAAAATACCACAAGAAGAGAAAAAAGCCTTACTTGAAGATGCGTTACAATATACGCCAAGTGCATTTAATCTGCAGCATTGGCGTCTTTTGGTTGTTGATGATGTTAAGCAACGTCAAGCATTAAGAAAAGTGGGTTGGGATCAGCCTCAAATAACAGACTCTGCTATGCTGATTGTTTTATGTGCAGATCTCAATGTTTGGGAGAGTGAAGTTAAAACAATTTGGCAAGATGCTAACCCTGAAGTCAGAGATATTATGTGCAGTGCTGTTGATAGTTATTATCGTAATAAACCACAAGTACAACGGGATGAGATTATGCGTAGTGCGGGTTTGTTTGCTCAAACACTGATGTTATTAGCACAAGAGCGCGGTTTTGATTCTTGTCCTATGGATGGGTTTGATTTTGCCGAGGTAGCAAAAACAATTAACTTGCCTGATCACTATGCTATCTGTTTAATGATTGCCATTGGTAAAGGTAAAGGAAAACCTTTTCCACGATTAGGTAAATTATCTTTTGATAAAGCGGTGACATTTGATCATTTTTAAAGTACTAAAGTGCTTCTTATATTTTATATAGGAAGTACTTTATTCCTATA