Homologs in group_86

Help

11 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05485 FBDBKF_05485 50.9 Morganella morganii S1 dsbB disulfide bond formation protein DsbB
FBDBKF_19840 FBDBKF_19840 48.8 Morganella morganii S1 dsbB disulfide bond formation protein DsbB
EHELCC_10565 EHELCC_10565 48.8 Morganella morganii S2 dsbB disulfide bond formation protein DsbB
EHELCC_12105 EHELCC_12105 50.9 Morganella morganii S2 dsbB disulfide bond formation protein DsbB
NLDBIP_10910 NLDBIP_10910 48.8 Morganella morganii S4 dsbB disulfide bond formation protein DsbB
NLDBIP_12445 NLDBIP_12445 50.9 Morganella morganii S4 dsbB disulfide bond formation protein DsbB
LHKJJB_10445 LHKJJB_10445 48.8 Morganella morganii S3 dsbB disulfide bond formation protein DsbB
LHKJJB_12305 LHKJJB_12305 50.9 Morganella morganii S3 dsbB disulfide bond formation protein DsbB
HKOGLL_10920 HKOGLL_10920 50.9 Morganella morganii S5 dsbB disulfide bond formation protein DsbB
HKOGLL_16610 HKOGLL_16610 48.8 Morganella morganii S5 dsbB disulfide bond formation protein DsbB
F4V73_RS03815 F4V73_RS03815 54.1 Morganella psychrotolerans dsbB disulfide bond formation protein DsbB

Distribution of the homologs in the orthogroup group_86

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_86

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3Z3 5.38e-66 202 55 2 173 3 dsbB Disulfide bond formation protein B Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JQQ3 2.39e-64 198 55 2 174 3 dsbB Disulfide bond formation protein B Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66AR0 1.83e-62 193 54 2 174 3 dsbB Disulfide bond formation protein B Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TJC8 1.83e-62 193 54 2 174 3 dsbB Disulfide bond formation protein B Yersinia pestis (strain Pestoides F)
Q1CJ90 1.83e-62 193 54 2 174 3 dsbB Disulfide bond formation protein B Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZEM1 1.83e-62 193 54 2 174 3 dsbB Disulfide bond formation protein B Yersinia pestis
Q1C7V4 1.83e-62 193 54 2 174 3 dsbB Disulfide bond formation protein B Yersinia pestis bv. Antiqua (strain Antiqua)
Q2NTB0 4.08e-61 190 53 1 165 3 dsbB Disulfide bond formation protein B Sodalis glossinidius (strain morsitans)
Q3Z2W3 6.84e-60 187 54 2 174 3 dsbB Disulfide bond formation protein B Shigella sonnei (strain Ss046)
Q31ZM6 6.84e-60 187 54 2 174 3 dsbB Disulfide bond formation protein B Shigella boydii serotype 4 (strain Sb227)
Q32H31 1.04e-59 186 54 2 174 3 dsbB Disulfide bond formation protein B Shigella dysenteriae serotype 1 (strain Sd197)
P0A6M2 1.04e-59 186 54 2 174 1 dsbB Disulfide bond formation protein B Escherichia coli (strain K12)
P0A6M3 1.04e-59 186 54 2 174 3 dsbB Disulfide bond formation protein B Escherichia coli O157:H7
Q54155 1.77e-59 186 54 2 174 3 dsbB Disulfide bond formation protein B Shigella flexneri
Q0T5L6 1.77e-59 186 54 2 174 3 dsbB Disulfide bond formation protein B Shigella flexneri serotype 5b (strain 8401)
Q1RCR1 2.57e-59 185 54 2 174 3 dsbB Disulfide bond formation protein B Escherichia coli (strain UTI89 / UPEC)
P59343 2.57e-59 185 54 2 174 3 dsbB Disulfide bond formation protein B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AAA8 2.57e-59 185 54 2 174 3 dsbB Disulfide bond formation protein B Escherichia coli O1:K1 / APEC
Q0TIJ0 1.25e-58 183 53 2 174 3 dsbB Disulfide bond formation protein B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P63993 4.97e-56 177 48 2 174 3 dsbB Disulfide bond formation protein B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63994 4.97e-56 177 48 2 174 3 dsbB Disulfide bond formation protein B Salmonella typhi
Q5PCR9 4.97e-56 177 48 2 174 3 dsbB Disulfide bond formation protein B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NK5 4.97e-56 177 48 2 174 3 dsbB Disulfide bond formation protein B Salmonella choleraesuis (strain SC-B67)
Q6D4M8 3.51e-55 175 54 2 174 3 dsbB Disulfide bond formation protein B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1RKH3 8.42e-53 169 47 0 168 3 dsbB Disulfide bond formation protein B Shewanella sp. (strain W3-18-1)
Q6LNY7 1.39e-52 168 47 1 169 3 dsbB Disulfide bond formation protein B Photobacterium profundum (strain SS9)
Q083H4 2.25e-52 167 50 0 168 3 dsbB Disulfide bond formation protein B Shewanella frigidimarina (strain NCIMB 400)
Q9KQU6 8.17e-52 166 48 0 169 3 dsbB Disulfide bond formation protein B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5E4B6 1.02e-49 160 47 1 172 3 dsbB Disulfide bond formation protein B Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q492M6 1.65e-48 158 47 1 168 3 dsbB Disulfide bond formation protein B Blochmanniella pennsylvanica (strain BPEN)
Q56578 1.81e-48 157 47 0 163 3 dsbB Disulfide bond formation protein B (Fragment) Vibrio alginolyticus
Q0HW69 2.52e-48 157 43 1 173 3 dsbB Disulfide bond formation protein B Shewanella sp. (strain MR-7)
Q0HJX3 2.52e-48 157 43 1 173 3 dsbB Disulfide bond formation protein B Shewanella sp. (strain MR-4)
P44707 2.8e-48 157 39 0 174 3 dsbB Disulfide bond formation protein B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59346 1.07e-47 155 42 0 168 3 dsbB Disulfide bond formation protein B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7MJN7 1.6e-47 155 45 0 169 3 dsbB Disulfide bond formation protein B Vibrio vulnificus (strain YJ016)
P59347 1.6e-47 155 45 0 169 3 dsbB Disulfide bond formation protein B Vibrio vulnificus (strain CMCP6)
Q4QNB7 1.65e-47 155 39 0 174 3 dsbB Disulfide bond formation protein B Haemophilus influenzae (strain 86-028NP)
Q87N03 2.78e-47 155 47 0 165 3 dsbB Disulfide bond formation protein B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KVP7 2.83e-47 154 42 1 173 3 dsbB Disulfide bond formation protein B Shewanella sp. (strain ANA-3)
A4SN81 3.21e-47 154 44 0 169 3 dsbB Disulfide bond formation protein B Aeromonas salmonicida (strain A449)
A1S6X5 9.14e-45 148 42 0 168 3 dsbB Disulfide bond formation protein B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KL09 9.24e-45 148 43 0 169 3 dsbB Disulfide bond formation protein B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3MZ39 4.91e-44 146 41 1 170 3 dsbB Disulfide bond formation protein B Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65VH4 7.29e-44 146 45 0 173 3 dsbB Disulfide bond formation protein B Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q12NQ9 1.17e-43 145 45 0 161 3 dsbB Disulfide bond formation protein B Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QWN6 1.27e-43 145 42 1 172 3 dsbB Disulfide bond formation protein B Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3QEZ4 8.42e-43 143 47 0 155 3 dsbB Disulfide bond formation protein B Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1SVD8 2.48e-41 140 48 0 169 3 dsbB Disulfide bond formation protein B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0I309 1.45e-39 135 40 0 165 3 dsbB Disulfide bond formation protein B Histophilus somni (strain 129Pt)
Q9L6B3 1.16e-36 128 39 0 173 3 dsbB Disulfide bond formation protein B Pasteurella multocida (strain Pm70)
Q7VQZ2 1.87e-35 124 39 1 174 3 dsbB Disulfide bond formation protein B Blochmanniella floridana
Q3IE23 3.11e-35 124 39 1 161 3 dsbB Disulfide bond formation protein B Pseudoalteromonas translucida (strain TAC 125)
Q7VKY2 6.43e-35 123 38 1 170 3 dsbB Disulfide bond formation protein B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q15S31 3.26e-33 119 36 2 162 3 dsbB Disulfide bond formation protein B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q47YD3 7.1e-31 113 40 1 169 3 dsbB Disulfide bond formation protein B Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q82VB9 1e-17 79 34 2 167 3 dsbB Disulfide bond formation protein B Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AFX4 1.87e-17 78 35 2 162 3 dsbB Disulfide bond formation protein B Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P57701 1.54e-16 75 29 3 173 3 dsbB2 Disulfide bond formation protein B 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TM7 1.54e-16 75 29 3 173 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q21WM5 9.91e-15 71 34 5 150 3 dsbB Disulfide bond formation protein B Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2YA85 3.13e-14 69 36 5 135 3 dsbB Disulfide bond formation protein B Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5P2Z1 3.96e-14 69 37 5 142 3 dsbB Disulfide bond formation protein B Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q12AY6 4.34e-14 69 33 5 153 3 dsbB Disulfide bond formation protein B Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0K9W2 4.27e-13 66 32 2 155 3 dsbB Disulfide bond formation protein B Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1VMI3 5.11e-13 66 34 6 149 3 dsbB Disulfide bond formation protein B Polaromonas naphthalenivorans (strain CJ2)
Q9XDP0 2.03e-12 65 30 3 140 3 dsbI Protein-disulfide oxidoreductase DsbI Lelliottia amnigena
Q8XZM2 2.82e-12 64 34 1 141 3 dsbB Disulfide bond formation protein B Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1LNJ0 1.2e-11 62 28 1 138 3 dsbB Disulfide bond formation protein B Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q4ZXC8 1.39e-11 62 31 3 144 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas syringae pv. syringae (strain B728a)
Q46ZY7 5.26e-11 61 30 2 155 3 dsbB Disulfide bond formation protein B Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P0A1H1 7.4e-11 62 28 3 140 3 dsbI Protein-disulfide oxidoreductase DsbI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1H2 7.4e-11 62 28 3 140 3 dsbI Protein-disulfide oxidoreductase DsbI Salmonella typhi
Q5PMU6 7.4e-11 62 28 3 140 3 dsbI Protein-disulfide oxidoreductase DsbI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57JR8 7.4e-11 62 28 3 140 3 dsbI Protein-disulfide oxidoreductase DsbI Salmonella choleraesuis (strain SC-B67)
Q8PNQ6 7.55e-11 60 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas axonopodis pv. citri (strain 306)
Q5H488 8.12e-11 60 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P728 8.12e-11 60 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q1R6U2 1.53e-10 60 27 4 141 3 dsbI Protein-disulfide oxidoreductase DsbI Escherichia coli (strain UTI89 / UPEC)
Q8FDI3 1.53e-10 60 27 4 141 1 dsbI Protein-disulfide oxidoreductase DsbI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD64 1.53e-10 60 27 4 141 3 dsbI Protein-disulfide oxidoreductase DsbI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFW3 1.53e-10 60 27 4 141 3 dsbI Protein-disulfide oxidoreductase DsbI Escherichia coli O1:K1 / APEC
Q3BWV6 2.53e-10 59 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q6F6X5 2.9e-10 59 27 5 176 3 dsbB Disulfide bond formation protein B Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q48M97 4.2e-10 58 30 2 142 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q887H2 5.84e-10 58 30 2 142 3 dsbB Disulfide bond formation protein B Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q0VSY8 7.94e-10 58 26 4 147 3 dsbB Disulfide bond formation protein B Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1VZK8 2.34e-09 58 27 4 138 3 dsbI Putative protein-disulfide oxidoreductase DsbI Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q1QU58 2.48e-09 57 32 5 138 3 dsbB Disulfide bond formation protein B Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5HUT1 3.25e-09 57 27 4 138 3 dsbI Putative protein-disulfide oxidoreductase DsbI Campylobacter jejuni (strain RM1221)
A1TXV0 3.98e-09 56 26 4 169 3 dsbB Disulfide bond formation protein B Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1WG92 4.95e-09 56 30 6 143 3 dsbB Disulfide bond formation protein B Verminephrobacter eiseniae (strain EF01-2)
Q4FVQ0 5.3e-09 56 34 8 150 3 dsbB Disulfide bond formation protein B Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q13V94 6.21e-09 55 30 1 139 3 dsbB Disulfide bond formation protein B Paraburkholderia xenovorans (strain LB400)
Q1QES7 1.09e-08 55 34 8 150 3 dsbB Disulfide bond formation protein B Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q3J7Z4 1.2e-08 55 33 5 130 3 dsbB Disulfide bond formation protein B Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q4K6L6 1.45e-08 54 30 2 146 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q47BA6 3.13e-08 53 29 6 157 3 dsbB Disulfide bond formation protein B Dechloromonas aromatica (strain RCB)
Q2S8G1 4.51e-08 53 31 4 154 3 dsbB Disulfide bond formation protein B Hahella chejuensis (strain KCTC 2396)
Q8PC32 5.21e-08 53 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URG5 5.21e-08 53 30 3 143 3 dsbB Disulfide bond formation protein B Xanthomonas campestris pv. campestris (strain 8004)
Q7NT68 6.16e-08 53 30 6 156 3 dsbB Disulfide bond formation protein B Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0PA25 6.19e-08 54 26 4 138 3 dsbI Putative protein-disulfide oxidoreductase DsbI Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9PGG2 8.18e-08 52 31 4 131 3 dsbB Disulfide bond formation protein B Xylella fastidiosa (strain 9a5c)
Q3K767 8.82e-08 52 28 2 150 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas fluorescens (strain Pf0-1)
P59345 1.11e-07 52 30 2 148 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1H058 1.43e-07 52 32 5 145 3 dsbB Disulfide bond formation protein B Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q602K4 1.45e-07 52 31 2 123 3 dsbB Disulfide bond formation protein B Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1TQ84 1.69e-07 52 27 3 137 3 dsbB Disulfide bond formation protein B Paracidovorax citrulli (strain AAC00-1)
A5WBG4 1.7e-07 52 31 9 157 3 dsbB Disulfide bond formation protein B Psychrobacter sp. (strain PRwf-1)
Q8EAM8 2.55e-07 52 24 4 172 3 dsbI Putative protein-disulfide oxidoreductase DsbI Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3MA10 7.36e-07 50 29 5 142 3 dsbB Disulfide bond formation protein B Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
A1W8C0 7.5e-07 50 28 3 135 3 dsbB Disulfide bond formation protein B Acidovorax sp. (strain JS42)
Q87AV3 8.27e-07 50 30 4 131 3 dsbB Disulfide bond formation protein B Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q21EN9 1.2e-06 49 27 2 143 3 dsbB Disulfide bond formation protein B Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q02EA7 1.69e-06 48 28 5 153 3 dsbB2 Disulfide bond formation protein B 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
P21482 1.69e-06 48 28 5 153 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3K4T4 2.1e-06 48 28 7 152 3 dsbB2 Disulfide bond formation protein B 2 Pseudomonas fluorescens (strain Pf0-1)
Q5F791 3.24e-06 48 30 7 152 3 dsbB Disulfide bond formation protein B Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1IEP6 4.37e-06 47 29 2 148 3 dsbB1 Disulfide bond formation protein B 1 Pseudomonas entomophila (strain L48)
A1KAY2 9.4e-06 47 31 3 120 3 dsbB Disulfide bond formation protein B Azoarcus sp. (strain BH72)
Q9JTA9 2.14e-05 45 29 6 143 3 dsbB Disulfide bond formation protein B Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A0RN51 3.27e-05 45 26 4 133 3 dsbI Putative protein-disulfide oxidoreductase DsbI Campylobacter fetus subsp. fetus (strain 82-40)
A1KV57 4.7e-05 45 28 7 152 3 dsbB Disulfide bond formation protein B Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q38ZZ5 7.19e-05 44 27 5 150 3 dsbB2 Disulfide bond formation protein B 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9JYC6 7.2e-05 44 28 6 143 3 dsbB Disulfide bond formation protein B Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q2SY47 0.000287 42 28 3 122 3 dsbB Disulfide bond formation protein B Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63RY4 0.000332 42 28 3 121 1 dsbB Disulfide bond formation protein B Burkholderia pseudomallei (strain K96243)
A3NXZ6 0.000332 42 28 3 121 3 dsbB Disulfide bond formation protein B Burkholderia pseudomallei (strain 1106a)
Q62M01 0.000332 42 28 3 121 3 dsbB Disulfide bond formation protein B Burkholderia mallei (strain ATCC 23344)
Q5WT71 0.000345 42 26 4 146 3 dsbB Disulfide bond formation protein B Legionella pneumophila (strain Lens)
A4VGY3 0.000641 42 25 4 139 3 dsbB Disulfide bond formation protein B Stutzerimonas stutzeri (strain A1501)
Q1IGS0 0.000886 41 30 6 138 3 dsbB2 Disulfide bond formation protein B 2 Pseudomonas entomophila (strain L48)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07330
Feature type CDS
Gene dsbB
Product disulfide bond formation protein DsbB
Location 1606876 - 1607400 (strand: 1)
Length 525 (nucleotides) / 174 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_86
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF02600 Disulfide bond formation protein DsbB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1495 Posttranslational modification, protein turnover, chaperones (O) O Disulfide bond formation protein DsbB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03611 protein dithiol:quinone oxidoreductase [EC:1.8.5.9] - -

Protein Sequence

MLSALRHWSQSRFSWLLLALTAIGLEGAALYFQYGMELMPCVMCVYQRIAVLGILVAALIGFSSPKLTLMRMAGSFLWLYASYRGIELAWEHTQLILNPSPFATCDFFVTLPSWFALQDWFPAVFQASGDCSVSQWRFLSLEMPQWMLIIFSAYFIVGLLVLISQVTSSFSKKD

Flanking regions ( +/- flanking 50bp)

AGTTTTTAGGCAGAATAACAACTTATTTCAATATTATCATGGACATTGTTATGTTGAGTGCTCTTCGTCACTGGTCACAAAGTCGTTTTTCATGGTTACTGCTGGCATTAACGGCAATTGGTCTTGAAGGTGCGGCATTGTATTTTCAGTACGGAATGGAATTAATGCCTTGTGTGATGTGTGTTTATCAGCGCATTGCTGTATTAGGGATCTTAGTTGCCGCATTAATTGGTTTTTCTTCGCCAAAACTGACACTAATGCGCATGGCGGGTAGTTTTTTATGGCTTTATGCCTCATACCGCGGTATTGAGCTAGCTTGGGAACATACGCAACTTATTCTTAATCCATCACCTTTTGCAACTTGTGATTTCTTTGTTACCTTGCCTTCTTGGTTTGCATTGCAAGATTGGTTCCCTGCCGTATTCCAAGCATCGGGGGATTGTTCTGTTAGCCAATGGCGGTTCTTGTCATTAGAAATGCCACAATGGATGTTAATTATCTTTTCTGCTTATTTTATTGTTGGTTTATTAGTATTAATCAGCCAAGTCACCTCTTCTTTTTCCAAAAAAGACTAACATACGCTACTGTTAGCTATAGAAAGATAGAGCGCAGATAAATTATTATC