Homologs in group_1049

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05425 FBDBKF_05425 61.5 Morganella morganii S1 yeaC DUF1315 domain-containing protein
EHELCC_12165 EHELCC_12165 61.5 Morganella morganii S2 yeaC DUF1315 domain-containing protein
NLDBIP_12505 NLDBIP_12505 61.5 Morganella morganii S4 yeaC DUF1315 domain-containing protein
LHKJJB_12365 LHKJJB_12365 61.5 Morganella morganii S3 yeaC DUF1315 domain-containing protein
HKOGLL_10980 HKOGLL_10980 61.5 Morganella morganii S5 yeaC DUF1315 domain-containing protein
F4V73_RS03870 F4V73_RS03870 58.2 Morganella psychrotolerans - DUF1315 family protein

Distribution of the homologs in the orthogroup group_1049

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1049

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76231 4.39e-35 117 65 0 79 4 yeaC Uncharacterized protein YeaC Escherichia coli (strain K12)
P56607 1.8e-19 78 37 0 82 4 None Uncharacterized protein in dagA 3'region Pseudoalteromonas haloplanktis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07280
Feature type CDS
Gene -
Product DUF1315 family protein
Location 1594807 - 1595088 (strand: -1)
Length 282 (nucleotides) / 93 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1049
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07023 Protein of unknown function (DUF1315)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3139 Function unknown (S) S Uncharacterized conserved protein YeaC, DUF1315 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09916 uncharacterized protein - -

Protein Sequence

MEVNDLISMVTPEIYQRLSTAVELGKWPDGVALTAEQKEHCMQIVLLWQAQNNHNPEHMTVGTNGQITMKSKQELKAQFQAERLATLTPMDDD

Flanking regions ( +/- flanking 50bp)

TAAAAAAACGATTCAGCTTTTGCGTGGTAATTTGATATATGGAGCAATCAATGGAAGTTAATGATTTAATTTCAATGGTCACACCTGAGATTTATCAACGTCTTTCTACCGCAGTTGAGCTAGGTAAATGGCCAGACGGCGTTGCACTCACGGCAGAGCAAAAAGAGCATTGCATGCAAATTGTTCTCTTATGGCAAGCGCAGAATAACCATAATCCGGAACATATGACGGTTGGCACAAACGGACAAATTACGATGAAAAGCAAACAAGAGCTAAAAGCGCAATTTCAAGCTGAACGTTTAGCCACATTAACACCAATGGATGATGATTAAGACGTTTTTAAATTTAAATAATGAAAGTTAGCGTAACGGTGGTGATTTAT