Homologs in group_1009

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05635 FBDBKF_05635 82.4 Morganella morganii S1 sapD putrescine export ABC transporter ATP-binding protein SapD
EHELCC_11955 EHELCC_11955 82.4 Morganella morganii S2 sapD putrescine export ABC transporter ATP-binding protein SapD
NLDBIP_12295 NLDBIP_12295 82.4 Morganella morganii S4 sapD putrescine export ABC transporter ATP-binding protein SapD
LHKJJB_12155 LHKJJB_12155 82.4 Morganella morganii S3 sapD putrescine export ABC transporter ATP-binding protein SapD
HKOGLL_10770 HKOGLL_10770 82.4 Morganella morganii S5 sapD putrescine export ABC transporter ATP-binding protein SapD
F4V73_RS03670 F4V73_RS03670 82.7 Morganella psychrotolerans sapD putrescine export ABC transporter ATP-binding protein SapD

Distribution of the homologs in the orthogroup group_1009

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1009

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAH7 0.0 553 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 0.0 553 79 0 328 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 0.0 553 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 0.0 553 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
P36636 0.0 551 78 0 328 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45288 5.83e-146 418 60 0 333 3 sapD Peptide transport system ATP-binding protein SapD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45095 1.89e-92 281 44 3 327 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAG2 2.14e-89 273 43 4 328 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 2.14e-89 273 43 4 328 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 2.14e-89 273 43 4 328 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
A0A0H2ZGN6 1.94e-82 255 41 4 328 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
P42064 1.66e-74 235 40 4 316 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q8FUW8 4.88e-71 226 40 2 306 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 4.88e-71 226 40 2 306 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 4.88e-71 226 40 2 306 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
P45052 1.24e-70 225 39 5 317 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8YDH0 1.22e-69 223 39 2 306 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YBN6 3.66e-64 209 35 5 338 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP1 4.63e-63 206 35 5 333 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
A5VU87 5.33e-63 206 35 5 333 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P04285 6.01e-63 206 35 5 324 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2YK63 7.51e-63 206 35 5 333 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 7.51e-63 206 35 5 333 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
Q53193 3.69e-62 204 37 6 324 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P76027 8.61e-61 200 34 4 324 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
P77268 2.48e-60 199 35 5 326 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
A2RI77 9.99e-60 198 35 2 299 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
P24136 1.23e-58 195 35 6 326 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
P63396 1.75e-58 201 37 5 322 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 1.25e-31 128 33 6 249 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 1.75e-58 201 37 5 322 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 1.25e-31 128 33 6 249 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 1.75e-58 201 37 5 322 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 1.25e-31 128 33 6 249 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P26905 1.15e-56 189 32 4 322 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
P0A2U9 3.1e-55 186 34 4 318 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 3.1e-55 186 34 4 318 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A9CKL2 3.37e-55 191 40 2 263 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 2.12e-26 112 31 5 241 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
P42065 4.54e-54 183 35 5 315 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
P50980 4.15e-53 181 34 3 304 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q07733 5.3e-53 180 34 3 304 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
P47325 6.6e-52 179 30 4 354 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P08007 2.47e-50 173 33 6 319 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3JXA3 2.49e-50 171 34 3 274 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
P77737 2.84e-50 173 33 7 329 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
P75552 2.92e-50 175 32 5 333 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2FVF0 2.83e-49 169 33 3 274 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
C0SP98 5.59e-49 169 32 8 337 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q2YJJ8 1.96e-48 168 32 8 311 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 1.96e-48 168 32 8 311 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q8YDH1 2.2e-47 167 32 8 311 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YBN5 1.03e-46 163 34 8 324 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 1.03e-46 163 34 8 324 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 1.03e-46 163 34 8 324 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 1.03e-46 163 34 8 324 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 1.03e-46 163 34 8 324 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P33916 3.11e-46 167 38 2 263 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 1.11e-29 122 30 4 264 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q8RDH4 5.57e-45 159 31 6 323 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0A0H2ZH52 8.79e-45 158 30 8 330 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q32IB5 1.32e-44 164 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 1.87e-32 130 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q8X6W1 1.36e-44 164 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 2.47e-32 130 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q3Z3V4 3.55e-44 163 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 3.22e-32 129 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q323W5 3.81e-44 163 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 2.92e-32 130 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q8FJL0 4.39e-44 162 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 2.29e-32 130 33 8 273 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q57RB2 4.62e-44 162 34 5 286 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 2.12e-33 133 30 7 295 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q8ZQM4 4.95e-44 162 34 4 280 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 1.96e-33 133 30 7 295 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0TJM0 5.48e-44 162 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 6.54e-32 129 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A967 5.76e-44 162 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 2.02e-30 124 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q1RE96 5.82e-44 162 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 9.19e-32 128 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q5PGP3 8.29e-44 162 33 4 280 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 1.48e-33 133 30 7 295 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z864 9.55e-44 162 34 4 280 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 1.98e-33 133 30 7 295 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q53194 1e-43 156 34 10 312 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P75796 1.1e-43 161 34 3 275 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 3.28e-32 129 31 7 272 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P24137 1.64e-43 154 34 3 261 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
Q83LT3 1.7e-43 161 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 7.49e-32 129 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q0T6D3 7.55e-43 159 34 3 275 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 7.57e-32 129 31 7 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
A2RI78 2.49e-42 152 34 5 262 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q6D3A9 3.81e-42 157 33 5 270 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 5.42e-33 132 32 6 271 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P72479 4.74e-42 151 33 5 263 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P37313 1.42e-40 147 30 8 311 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P45051 4.01e-40 146 30 6 320 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77622 1.27e-37 139 30 7 292 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
P18766 1.74e-37 139 30 4 262 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04F14 2.12e-37 140 30 7 293 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q3A9G5 6.4e-37 138 32 9 270 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8P2L5 2.49e-36 135 28 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P45094 3.64e-36 136 29 7 291 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0CZ33 4.08e-36 135 29 5 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 4.08e-36 135 29 5 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 4.08e-36 135 29 5 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 4.08e-36 135 29 5 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
Q5FKL2 6.73e-36 135 31 8 282 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P0A2V5 1.37e-35 134 32 4 259 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 1.37e-35 134 32 4 259 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q8EPK1 2.87e-34 131 29 6 263 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03Z27 3.14e-34 131 31 8 277 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q0SFW6 4.62e-34 130 30 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q6NJ07 2.19e-33 129 31 7 284 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q74IV9 2.45e-33 129 31 8 263 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8G5P8 2.81e-33 130 32 9 284 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q5PCG9 5.18e-33 128 29 8 279 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8R5 6.57e-33 127 29 8 279 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q8ZR89 8.17e-33 127 29 8 279 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q832Y6 1.06e-32 127 30 6 262 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q03P57 2.61e-32 126 29 5 267 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q043Y8 1.12e-31 124 31 8 264 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8NWT5 1.95e-31 121 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q8FRX8 2.38e-31 124 32 8 266 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6GH27 2.38e-31 121 28 4 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q6G9I0 2.54e-31 121 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 2.54e-31 121 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 2.54e-31 121 30 5 260 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 2.54e-31 121 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
Q134N9 4.14e-31 123 31 5 243 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q57S53 5.35e-31 122 29 8 279 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q13VD7 8.06e-31 122 31 7 270 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q8NSN2 9.87e-31 122 31 7 266 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q2YXY9 1.98e-30 119 29 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A5Q8 2.39e-30 119 28 4 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 2.39e-30 119 28 4 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5M1F6 3.16e-30 120 29 9 296 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q1BY14 3.92e-30 120 32 9 269 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 3.92e-30 120 32 9 269 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q2SY12 4.04e-30 120 32 9 271 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q04DA7 4.22e-30 120 29 6 264 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5M5Z2 4.25e-30 120 29 10 297 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q89LP2 6.38e-30 119 32 9 264 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6N9W0 1.45e-29 119 31 6 246 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8ELA5 1.56e-29 119 28 9 270 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9CIN4 1.86e-29 119 26 5 287 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q5WKL3 1.89e-29 118 30 7 260 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q5WJP0 2.12e-29 118 30 5 263 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q8DY54 2.13e-29 118 28 10 334 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 2.13e-29 118 28 10 334 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q63S19 2.26e-29 118 32 8 268 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 2.26e-29 118 32 8 268 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 2.26e-29 118 32 8 268 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q8E3S0 2.39e-29 118 28 10 334 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q65VG9 2.4e-29 118 30 9 273 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8ELQ6 2.63e-29 118 30 6 263 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q39IE7 2.67e-29 118 31 9 264 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
D8KFN1 2.82e-29 118 27 6 290 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 2.82e-29 118 27 6 290 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q4QMH4 2.83e-29 118 30 9 274 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q5XDS8 3.54e-29 118 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ31 3.69e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 3.69e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48V78 4.13e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 4.13e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q6A6X6 4.16e-29 118 28 5 261 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q1J8E4 4.21e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q83J78 4.52e-29 115 29 5 263 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q032A0 5.98e-29 117 27 6 290 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q0BH79 6.3e-29 117 31 9 264 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1JNE0 6.6e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 6.6e-29 117 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5KVK2 6.8e-29 117 28 4 260 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q07LR5 6.94e-29 117 30 7 261 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
Q2NRN5 8.15e-29 116 29 8 300 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q831K6 9.74e-29 116 29 7 271 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8DRF9 1.33e-28 116 31 7 261 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q6HP89 1.48e-28 115 29 7 264 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81ZF5 1.62e-28 115 29 7 264 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q1JII9 1.67e-28 116 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q97T09 1.78e-28 116 31 7 261 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8P2K6 1.83e-28 116 28 9 304 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q73EL7 1.87e-28 115 29 7 264 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9L1C3 1.91e-28 115 33 6 246 3 metN Methionine import ATP-binding protein MetN Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8Y4L8 1.98e-28 115 30 6 286 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0SZJ4 2e-28 113 29 5 263 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q1IGZ0 2.08e-28 115 27 4 258 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q5WDP1 2.3e-28 115 29 6 266 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q7A7E3 2.42e-28 115 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 2.42e-28 115 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q81IN8 2.44e-28 115 29 7 264 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q928L8 2.46e-28 115 29 7 288 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O32169 2.63e-28 115 27 4 262 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
P44785 2.84e-28 115 30 9 274 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1R5D9 2.93e-28 113 29 5 263 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 2.93e-28 113 29 5 263 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FCN0 3.18e-28 113 29 5 263 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X5U1 3.25e-28 113 29 5 263 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
P33593 4.04e-28 112 29 5 263 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q5HQQ9 4.38e-28 114 28 9 280 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4KKK8 5.42e-28 114 29 7 258 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q63GR8 6.7e-28 114 29 7 264 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q3JHC9 6.84e-28 115 31 10 287 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q8NY21 6.93e-28 114 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 6.93e-28 114 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q6GJL2 7.07e-28 114 28 6 261 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q03A07 8.56e-28 114 30 7 262 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8CTB2 9.13e-28 114 28 9 280 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9KTJ5 9.41e-28 114 29 9 276 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q71X09 1.39e-27 113 29 6 286 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q2YVT7 1.49e-27 113 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q32AQ2 1.62e-27 111 28 5 263 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q3YW49 1.64e-27 111 28 5 263 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q49W48 1.75e-27 113 28 8 284 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q88UV2 1.81e-27 113 31 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6GIH9 1.82e-27 113 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q63NI4 2.2e-27 114 31 10 287 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q31VE7 2.23e-27 110 28 5 263 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
Q8NXH5 2.26e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 2.26e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 2.26e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 2.26e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 2.26e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q0I5E9 2.75e-27 112 30 7 263 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q88WA5 2.98e-27 112 30 6 258 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q2YWP2 3.07e-27 112 28 8 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q63H29 3.07e-27 112 29 9 266 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q5YRD1 3.7e-27 112 32 6 242 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q7N8M2 3.8e-27 112 30 6 253 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q12B04 3.85e-27 112 30 5 260 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5HIL5 4.03e-27 112 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 4.03e-27 112 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 4.03e-27 112 28 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q6D3Q6 4.56e-27 112 30 8 267 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q88RL5 5.11e-27 111 29 4 241 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q81VM2 6.18e-27 111 29 9 266 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q53I83 6.22e-27 112 32 7 251 3 metN Methionine import ATP-binding protein MetN Streptomyces griseus
Q3J1N0 6.5e-27 112 30 7 268 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q97EK9 6.67e-27 110 33 9 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0AAI0 6.9e-27 110 28 7 265 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 6.9e-27 110 28 7 265 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 6.9e-27 110 28 7 265 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q93DA2 7.16e-27 111 28 7 272 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q827Y0 7.39e-27 111 31 5 244 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9K789 7.43e-27 111 29 5 262 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7A6M2 9.47e-27 111 28 8 276 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 9.47e-27 111 28 8 276 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q3KK97 9.89e-27 110 26 5 283 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q21BU8 9.9e-27 111 32 8 246 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q4JTG9 1.01e-26 111 27 7 270 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q7VM95 1.16e-26 110 27 7 287 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6F9P2 1.22e-26 110 25 5 260 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q73F11 1.26e-26 110 29 9 266 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q4L4R9 1.39e-26 110 27 6 274 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
Q4KK46 1.49e-26 111 29 8 275 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q62B84 1.77e-26 111 30 10 287 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q1LQF6 2.33e-26 110 29 8 263 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1GAN9 2.73e-26 110 29 9 275 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04B25 2.93e-26 110 29 9 275 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q8YCN8 3.07e-26 108 28 4 260 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 3.07e-26 108 28 4 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 3.07e-26 108 28 4 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
Q8ENU2 5.56e-26 108 28 6 260 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7MN25 5.85e-26 108 28 8 276 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q81IZ6 5.92e-26 108 28 7 261 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1WVG9 7.07e-26 108 28 6 260 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q8YA75 7.07e-26 108 29 7 263 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6N798 7.66e-26 109 29 7 282 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q92EZ6 7.66e-26 108 29 7 263 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2RS21 7.82e-26 107 27 4 258 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q0SFY5 7.9e-26 108 30 8 260 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q724C0 8.23e-26 108 29 7 263 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q88HL1 8.73e-26 106 29 5 268 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2KVK2 1.09e-25 108 29 8 260 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q8FVM9 1.14e-25 106 27 4 260 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q6LN52 1.2e-25 108 28 8 277 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q65F80 1.22e-25 108 27 6 265 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8DFC3 1.61e-25 107 28 8 276 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q48PU6 1.66e-25 107 28 7 258 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q92LX3 1.72e-25 108 30 7 246 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q0KDG3 1.76e-25 107 29 9 271 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q87RS1 1.8e-25 107 27 9 286 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6D5H7 2.41e-25 107 29 6 270 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q20ZP0 2.73e-25 105 30 7 254 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q8Y0X3 3.46e-25 107 28 10 272 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q46Y69 3.64e-25 107 28 7 260 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q6G2E2 3.71e-25 107 29 9 262 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2RWA3 3.92e-25 107 28 6 257 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P16678 4.56e-25 104 28 5 263 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q4L884 4.72e-25 105 28 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q0BMC9 4.92e-25 106 28 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 4.92e-25 106 28 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q5E715 4.93e-25 106 27 8 277 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8FV85 5.58e-25 106 28 7 263 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 5.58e-25 106 28 7 263 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 5.58e-25 106 28 7 263 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 5.58e-25 106 28 7 263 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q8P4S7 6.11e-25 106 28 8 282 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 6.11e-25 106 28 8 282 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q0TLD2 6.12e-25 106 29 6 283 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6HBS0 6.7e-25 106 28 5 264 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6GEL4 6.83e-25 105 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q65M34 6.89e-25 105 29 5 245 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P36638 7.32e-25 104 27 7 265 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32JQ8 7.95e-25 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q44613 8.56e-25 103 31 5 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q72Y96 8.97e-25 105 29 5 260 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
P30750 9.15e-25 105 29 6 281 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q3Z5F8 9.34e-25 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 9.34e-25 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 9.34e-25 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 9.34e-25 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q81XL3 9.53e-25 105 28 5 264 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q631Y4 9.63e-25 105 29 5 260 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q815Y7 9.92e-25 105 29 5 260 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P17328 1.07e-24 106 29 5 241 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83MC5 1.19e-24 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.19e-24 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q4ZZK0 1.29e-24 105 28 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
Q6D1C4 1.36e-24 105 29 7 271 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2RPB4 1.38e-24 107 31 7 238 3 macB Macrolide export ATP-binding/permease protein MacB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q1CFH7 1.42e-24 105 28 8 282 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 1.42e-24 105 28 8 282 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 1.42e-24 105 28 8 282 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZRM9 1.56e-24 105 28 7 281 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q325U1 1.59e-24 105 29 6 281 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q1DDP4 1.71e-24 104 30 7 254 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
P14175 1.78e-24 105 29 5 241 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q57T09 1.81e-24 105 28 7 281 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q17VE0 1.83e-24 104 28 7 250 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q1CR30 1.96e-24 104 28 7 250 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
O26096 2.06e-24 104 28 7 250 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q9PF03 2.3e-24 104 30 9 244 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q9I1C8 2.4e-24 105 29 9 267 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8RFN2 2.77e-24 104 29 8 260 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2YYM5 3.59e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A088 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 3.7e-24 103 28 4 227 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 3.7e-24 103 28 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q5PID0 3.82e-24 103 28 7 281 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8U7G2 4.18e-24 104 30 9 272 3 metN Methionine import ATP-binding protein MetN Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4ZZR8 4.27e-24 103 27 7 258 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q87UN4 4.44e-24 103 27 7 258 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8NQU4 5.03e-24 102 28 9 253 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8X4L6 5.21e-24 102 29 7 255 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q8Z990 5.53e-24 103 28 6 281 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
E0SCY1 6.13e-24 104 29 5 245 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
A0PXX8 6.65e-24 102 29 8 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q2IYS5 6.76e-24 102 30 7 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q02ME3 6.85e-24 103 29 9 267 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q5HV18 8.24e-24 103 27 10 276 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 8.24e-24 103 27 10 276 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5NFU5 8.33e-24 103 28 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q39AT4 8.56e-24 103 28 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7VV72 9.14e-24 103 27 10 289 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 9.14e-24 103 27 10 289 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 9.14e-24 103 27 10 289 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q07PZ0 9.28e-24 101 31 7 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q14H97 9.4e-24 103 28 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q7CHF8 9.49e-24 102 29 5 245 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 9.49e-24 102 29 5 245 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 9.49e-24 102 29 5 245 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 9.49e-24 102 29 5 245 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q6ME20 1.13e-23 102 30 9 262 3 metN Methionine import ATP-binding protein MetN Protochlamydia amoebophila (strain UWE25)
Q8ZPK4 1.17e-23 103 29 9 261 1 osmV Osmoprotectant import ATP-binding protein OsmV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HT70 1.33e-23 102 30 6 232 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 1.33e-23 102 30 6 232 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q0AU85 1.35e-23 102 29 7 264 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q38WL5 1.38e-23 102 28 7 257 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q8CQS7 1.48e-23 102 26 7 271 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 1.48e-23 102 26 7 271 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3BNZ3 1.54e-23 102 29 6 237 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87AL9 1.56e-23 102 29 9 246 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q667L9 1.6e-23 102 28 8 282 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1BR30 1.62e-23 103 28 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 1.62e-23 103 28 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q18CI9 1.68e-23 101 31 6 229 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q48PN3 2.91e-23 102 28 6 258 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9S4Z0 2.92e-23 101 27 8 258 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q21XK2 3.7e-23 101 27 7 263 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q24QI5 4.3e-23 101 26 6 273 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
O34992 4.4e-23 101 28 6 254 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
A3DJK5 4.51e-23 100 27 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q0B6I6 4.93e-23 101 28 10 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q9A502 5.07e-23 100 32 9 251 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9ZJ34 5.21e-23 100 27 7 250 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q67SV5 5.23e-23 100 29 7 251 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q13LD8 5.3e-23 101 28 7 250 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q1B677 5.92e-23 100 25 5 271 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q492R2 6.91e-23 98 29 4 224 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella pennsylvanica (strain BPEN)
Q7M816 8.4e-23 99 29 5 228 3 metN Methionine import ATP-binding protein MetN Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6FAN3 9.79e-23 100 28 8 259 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P33594 1.05e-22 98 30 5 228 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q8PGE8 1.21e-22 99 29 6 237 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q31VE6 1.34e-22 98 30 7 229 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q5WVL8 1.64e-22 99 32 8 220 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q45460 1.69e-22 100 27 7 292 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q5HM28 1.93e-22 98 26 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6AE21 2.1e-22 99 28 5 247 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q8CRI7 2.14e-22 98 26 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2RS22 2.25e-22 97 30 7 267 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9CK97 2.33e-22 99 30 9 252 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q49ZD9 2.55e-22 98 25 5 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P31134 2.62e-22 99 27 8 271 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q32AQ1 2.7e-22 97 30 6 228 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q3YW48 2.78e-22 97 30 6 224 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q5ZUG5 2.82e-22 99 31 8 220 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X484 3.47e-22 98 31 8 220 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q03EE4 3.49e-22 97 28 8 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q2JLH7 3.61e-22 97 29 6 245 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q1R0Z6 4.4e-22 97 29 7 254 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2FVF1 4.53e-22 96 29 5 244 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JT74 5.01e-22 96 30 6 244 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q18C09 5.06e-22 97 27 8 261 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q2P7S3 5.75e-22 97 28 7 263 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q1R5D8 6.99e-22 96 30 5 223 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 6.99e-22 96 30 5 223 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 6.99e-22 96 30 5 223 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9KGD6 7.48e-22 96 28 5 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7M8M4 7.61e-22 96 29 6 245 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5H503 8.4e-22 97 28 7 263 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q87UV4 9.14e-22 97 27 6 256 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A0LM36 1.01e-21 99 28 5 218 3 macB Macrolide export ATP-binding/permease protein MacB Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P10346 1.38e-21 95 25 9 262 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q4KBU0 1.38e-21 96 30 9 257 3 metN3 Methionine import ATP-binding protein MetN 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q58639 1.39e-21 98 27 6 248 3 MJ1242 Uncharacterized ABC transporter ATP-binding protein MJ1242 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58639 3.38e-11 67 23 8 278 3 MJ1242 Uncharacterized ABC transporter ATP-binding protein MJ1242 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7VI92 1.87e-21 96 27 9 285 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q0SZJ3 1.9e-21 95 29 6 228 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q9RR46 1.99e-21 97 28 5 251 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q8FVN0 2.31e-21 95 29 6 233 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q890R3 2.55e-21 95 29 7 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q8YCN7 2.58e-21 94 29 6 233 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 2.58e-21 94 29 6 233 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 2.58e-21 94 29 6 233 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q83J77 2.62e-21 94 30 7 229 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
P39456 3.12e-21 94 26 8 262 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q9KHT9 3.21e-21 96 26 7 280 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 3.21e-21 96 26 7 280 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q32EX7 4.34e-21 93 30 5 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q98DA2 5.09e-21 95 31 7 246 3 metN Methionine import ATP-binding protein MetN Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8DQH4 5.26e-21 93 30 10 242 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 5.26e-21 93 30 10 242 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q3KJS6 5.29e-21 95 28 9 272 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
P54537 6.31e-21 93 26 7 245 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q1WSB9 7.67e-21 94 24 5 244 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
P46920 9.91e-21 95 27 5 251 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q8REG7 1e-20 92 26 6 235 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1M8E0 1.01e-20 94 31 7 243 3 metN Methionine import ATP-binding protein MetN Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P27675 1.11e-20 92 27 9 248 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q5YZY9 1.18e-20 94 25 7 270 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
P55662 1.31e-20 92 24 7 255 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q839D4 1.46e-20 93 27 9 250 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
P75957 1.67e-20 91 30 6 240 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q03PY6 2.67e-20 92 26 5 226 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q18CJ0 3.13e-20 92 26 7 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
P75551 3.78e-20 94 32 1 136 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75551 1.32e-07 57 30 1 107 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47326 4.46e-20 94 32 1 136 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47326 1.09e-06 53 28 1 107 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q58206 4.79e-20 90 28 8 237 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q38UT9 5.21e-20 91 26 9 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q47RE8 5.36e-20 92 33 7 251 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q8E8K8 5.56e-20 92 27 7 271 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9V1Q4 6.89e-20 91 26 6 255 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q6KHL1 7.19e-20 90 27 9 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P61482 7.41e-20 90 29 5 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 7.41e-20 90 29 5 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 7.41e-20 90 29 5 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q032D0 7.46e-20 90 28 6 232 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q7N3A6 7.94e-20 90 27 4 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2K284 8.52e-20 92 30 7 248 3 metN Methionine import ATP-binding protein MetN Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3Z300 8.97e-20 89 30 6 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 8.97e-20 89 30 6 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 8.97e-20 89 30 6 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 8.97e-20 89 30 6 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5E0B3 9.89e-20 89 27 8 251 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q3A558 1.17e-19 89 28 5 224 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8PC11 1.21e-19 91 24 6 279 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q57QD7 1.28e-19 89 29 5 240 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q5UW69 1.36e-19 90 28 8 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q71WT2 1.46e-19 90 27 8 251 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serotype 4b (strain F2365)
Q927Z7 1.65e-19 90 27 8 251 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y4E9 1.75e-19 89 27 8 251 3 pstB2 Phosphate import ATP-binding protein PstB 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A0R8K9 1.78e-19 90 25 9 282 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q9KIF7 1.84e-19 91 26 6 256 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
P63354 1.99e-19 91 27 5 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 1.99e-19 91 27 5 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q032H4 2.03e-19 89 26 9 281 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 2.03e-19 89 26 9 281 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q2NHA1 2.12e-19 89 25 8 248 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q88ZZ2 2.22e-19 92 28 8 247 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 2.71e-09 62 22 6 248 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6WB63 2.39e-19 89 29 6 237 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q8D3Z9 2.59e-19 92 28 7 249 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 2.51e-08 58 21 6 259 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
P0A9S0 2.6e-19 88 29 6 222 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 2.6e-19 88 29 6 222 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 2.6e-19 88 29 6 222 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 2.6e-19 88 29 6 222 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
Q73YZ5 3.51e-19 88 28 6 221 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 3.51e-19 88 28 6 221 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q88RB3 3.67e-19 90 26 5 257 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O34979 4e-19 87 28 6 236 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q72GX5 4.89e-19 88 26 11 263 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q73F66 6.04e-19 89 25 9 282 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1QVQ7 6.67e-19 89 29 9 236 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9CIQ6 6.81e-19 87 27 6 232 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q5SLN1 7.82e-19 88 26 11 263 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A3CRB9 8.91e-19 88 27 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q31ZH4 9.01e-19 87 28 6 247 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q9CIS9 1.06e-18 87 25 9 281 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q88XV1 1.06e-18 88 26 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6HPM9 1.07e-18 88 25 9 282 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.07e-18 88 25 9 282 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
P14788 1.08e-18 89 25 6 260 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7MFH3 1.1e-18 90 27 7 249 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 2.01e-08 59 21 6 259 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
P33360 1.16e-18 88 26 6 261 1 yehX Glycine betaine uptake system ATP-binding protein YehX Escherichia coli (strain K12)
Q83GE8 1.17e-18 87 28 10 263 3 pstB Phosphate import ATP-binding protein PstB Tropheryma whipplei (strain Twist)
Q8R7Y5 1.25e-18 87 26 10 266 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06670
Feature type CDS
Gene sapD
Product putrescine export ABC transporter ATP-binding protein SapD
Location 1459460 - 1460461 (strand: 1)
Length 1002 (nucleotides) / 333 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1009
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter
PF08352 Oligopeptide/dipeptide transporter, C-terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4170 Defense mechanisms (V) V ABC-type antimicrobial peptide export system, ATPase component SapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19229 cationic peptide transport system ATP-binding protein Cationic antimicrobial peptide (CAMP) resistance
ABC transporters		 -

Protein Sequence

MPLLDIRNLTIEFMTPDGPVKAVDRVSITLSEGEVRGLVGESGSGKSLIAKAICGVTKDNIKVTADRFRFDDIDLLKLSPRARRRVIGHNVSMIFQEPQSCLDPATKIEHQLIQAIPGWTFKGHWWQRFHWRKRRAIELLHRVGIKDHKDIMRSYPYELTEGECQKVMIAIAIANQPRLLIADEPTNAMEPATQTQIFRLLTRLNQNNNMTILLISHDLQWMSKLASKITVMYCGQTVETAIPEELLVTPYHPYTQALIRSIPDFTNSLPHKSRLNTLPGAIPSLEHLPVGCRLGPRCPYAQRQCIEAPRLRTFKNHAVACHFPLNVETTDVR

Flanking regions ( +/- flanking 50bp)

AATTTATTAGGGGATGGCTTACAACGTGCCATTAATGAGGGGGTGGAATAATGCCGTTATTAGACATACGCAACCTAACTATTGAGTTTATGACACCCGATGGCCCAGTAAAAGCGGTAGATCGCGTTTCCATTACCCTCAGTGAGGGAGAAGTAAGAGGTTTAGTCGGTGAATCTGGCTCCGGAAAAAGTTTGATCGCTAAGGCAATTTGTGGCGTGACTAAAGATAATATTAAAGTGACTGCGGATCGCTTTCGGTTTGATGATATTGATTTACTTAAATTGTCACCAAGAGCACGTCGTCGGGTAATTGGTCATAATGTGTCGATGATTTTCCAAGAGCCTCAATCTTGTCTTGATCCGGCGACCAAAATTGAACACCAGCTTATTCAAGCAATCCCTGGTTGGACATTTAAAGGCCACTGGTGGCAACGTTTTCATTGGCGAAAACGCCGTGCAATTGAGTTACTTCATCGGGTTGGTATTAAAGATCATAAAGATATCATGCGTAGCTATCCTTATGAGTTAACCGAGGGTGAATGCCAAAAAGTGATGATAGCCATTGCCATTGCTAACCAACCCCGTTTACTGATTGCCGATGAACCAACTAATGCGATGGAGCCGGCAACGCAAACACAAATATTTCGTTTACTCACCCGTTTAAATCAAAATAATAATATGACTATTTTGTTAATTAGCCATGATTTGCAGTGGATGAGTAAATTAGCCAGTAAAATTACGGTCATGTATTGTGGTCAGACCGTGGAAACCGCCATACCTGAAGAACTATTGGTTACCCCCTATCATCCTTATACACAAGCCCTTATCCGCTCTATTCCTGATTTTACTAACTCTTTGCCTCATAAAAGCCGTTTAAATACGCTACCCGGTGCGATCCCCTCTTTAGAGCACCTACCTGTTGGGTGCCGTTTAGGCCCCCGTTGTCCTTATGCACAACGTCAATGTATTGAAGCACCTCGATTACGTACATTTAAAAATCATGCGGTGGCTTGTCATTTCCCATTAAATGTGGAGACGACAGATGTTCGATAAATTACTTGAAGTCAAAAACTTATCAAAAACATTTCGTTACCGTACAGGAT