Homologs in group_1076

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05635 FBDBKF_05635 96.4 Morganella morganii S1 sapD putrescine export ABC transporter ATP-binding protein SapD
EHELCC_11955 EHELCC_11955 96.4 Morganella morganii S2 sapD putrescine export ABC transporter ATP-binding protein SapD
NLDBIP_12295 NLDBIP_12295 96.4 Morganella morganii S4 sapD putrescine export ABC transporter ATP-binding protein SapD
LHKJJB_12155 LHKJJB_12155 96.4 Morganella morganii S3 sapD putrescine export ABC transporter ATP-binding protein SapD
HKOGLL_10770 HKOGLL_10770 96.4 Morganella morganii S5 sapD putrescine export ABC transporter ATP-binding protein SapD
PMI_RS06670 PMI_RS06670 82.7 Proteus mirabilis HI4320 sapD putrescine export ABC transporter ATP-binding protein SapD

Distribution of the homologs in the orthogroup group_1076

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1076

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36636 0.0 554 79 0 328 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AAH7 0.0 554 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 0.0 554 79 0 328 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 0.0 554 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 0.0 554 79 0 328 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
P45288 2.98e-146 419 62 0 329 3 sapD Peptide transport system ATP-binding protein SapD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45095 2.29e-91 278 43 4 327 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAG2 3.74e-88 270 42 4 328 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 3.74e-88 270 42 4 328 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 3.74e-88 270 42 4 328 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
A0A0H2ZGN6 2.24e-79 248 41 5 329 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
P42064 1.24e-74 236 40 6 324 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q8FUW8 1.99e-70 225 39 3 307 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 1.99e-70 225 39 3 307 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 1.99e-70 225 39 3 307 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
Q8YDH0 1.46e-69 223 38 4 323 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P45052 3.42e-67 216 38 4 315 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q53193 1.26e-66 215 38 4 304 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P04285 2.99e-65 212 36 6 325 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P76027 1.66e-64 210 37 6 328 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q8YBN6 7.88e-64 208 36 5 320 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P77268 2.35e-63 206 37 5 328 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
A5VU87 3.33e-63 206 36 6 324 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8FWP1 3.95e-63 206 36 5 320 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
Q2YK63 4.31e-63 206 36 5 320 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 4.31e-63 206 36 5 320 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
P26905 5.74e-61 201 34 4 317 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
A2RI77 1.68e-59 197 34 3 305 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
P24136 8.15e-59 196 35 5 307 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
P63396 1.33e-57 199 37 4 307 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 9.67e-30 122 31 6 248 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 1.33e-57 199 37 4 307 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 9.67e-30 122 31 6 248 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 1.33e-57 199 37 4 307 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 9.67e-30 122 31 6 248 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P42065 8e-55 184 35 5 313 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
P0A2U9 3.23e-54 184 33 4 303 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 3.23e-54 184 33 4 303 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P50980 3.8e-53 181 33 6 328 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q07733 6.14e-53 180 33 6 328 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
C0SP98 1.1e-51 176 34 8 334 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
P47325 4.33e-51 177 32 6 335 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P08007 1.12e-50 174 36 7 312 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9CKL2 1.14e-50 179 38 3 272 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 3.74e-27 114 30 5 247 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
P77737 3.16e-50 173 35 8 329 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
P75552 1.24e-49 174 31 5 336 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8YBN5 1.66e-49 171 34 8 324 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 1.66e-49 171 34 8 324 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 1.66e-49 171 34 8 324 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 1.66e-49 171 34 8 324 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 1.66e-49 171 34 8 324 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A0A0H3JXA3 1.33e-47 164 33 3 274 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YJJ8 2.01e-47 166 33 8 310 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 2.01e-47 166 33 8 310 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q8X6W1 5.2e-47 171 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 5.91e-35 137 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q3Z3V4 6.77e-47 170 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 1.01e-34 136 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q0TJM0 8.22e-47 170 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 1.56e-34 136 31 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A967 1.04e-46 170 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 5.45e-33 132 31 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q1RE96 1.14e-46 169 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 3.04e-34 135 31 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q8FJL0 1.5e-46 169 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 1.27e-34 136 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2FVF0 1.57e-46 161 33 3 274 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8YDH1 1.73e-46 164 33 8 310 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q323W5 1.93e-46 169 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 1e-34 136 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
P75796 2.59e-46 169 33 9 333 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 1.11e-34 136 32 8 297 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q32IB5 7.46e-46 167 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 6.52e-35 137 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q6D3A9 7.69e-46 167 36 5 269 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 1.74e-34 136 32 7 273 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57RB2 1.11e-45 167 34 4 278 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 5.31e-35 137 32 10 304 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q83LT3 2.16e-45 166 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 3.85e-34 135 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q0T6D3 2.32e-45 166 33 9 333 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 3.46e-34 135 32 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q8ZQM4 3.49e-45 166 34 4 276 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 5.68e-35 137 32 10 304 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP3 6.09e-45 165 34 4 276 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 8.93e-35 137 31 8 297 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z864 6.34e-45 165 34 4 276 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 5.63e-35 137 32 10 304 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8RDH4 1.5e-44 158 30 6 323 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0A0H2ZH52 3.32e-44 157 30 8 331 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
P24137 2.31e-43 154 34 4 269 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
Q53194 7.7e-43 154 32 9 331 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P33916 9.2e-43 157 37 3 263 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 9.64e-29 119 30 4 264 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P45051 3.6e-42 152 32 6 320 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2RI78 4.09e-41 148 35 8 264 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
P72479 2.31e-40 146 32 7 280 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P77622 7.85e-40 145 31 7 292 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
P18766 2.37e-39 144 33 6 263 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0A2V5 6.9e-39 143 32 6 285 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 6.9e-39 143 32 6 285 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
P37313 5.29e-38 141 30 8 312 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
Q04F14 1.91e-37 140 31 7 291 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8EPK1 2.98e-37 139 31 6 275 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8Z8R5 4.17e-37 139 32 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q5PCG9 9.82e-37 137 32 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3A9G5 1.22e-36 137 33 9 272 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8ZR89 1.54e-36 137 32 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45094 2.64e-36 136 29 8 291 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8P2L5 2.23e-35 133 29 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q832Y6 3.06e-35 134 31 7 272 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
P0CZ33 3.8e-35 132 29 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 3.8e-35 132 29 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 3.8e-35 132 29 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 3.8e-35 132 29 4 262 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
Q13VD7 4.1e-35 133 34 7 278 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q0SFW6 6.42e-35 133 29 7 326 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q57S53 8.17e-35 132 31 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q6NJ07 3.18e-34 131 31 8 284 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5M1F6 6.53e-34 130 30 8 297 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q5M5Z2 1.02e-33 130 30 8 297 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q8G5P8 1.03e-33 131 31 7 263 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q03P57 1.12e-33 130 29 6 267 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5WKL3 1.34e-33 129 30 7 265 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q1BY14 2.74e-33 129 33 8 283 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 2.74e-33 129 33 8 283 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q5KVK2 3.21e-33 128 31 7 275 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q81ZF5 6.66e-33 127 31 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q6HP89 7.08e-33 127 31 6 263 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q73EL7 9.37e-33 127 31 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q39IE7 1.36e-32 127 33 8 278 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5XDS8 2.09e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q81IN8 2.12e-32 126 31 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1LQF6 2.13e-32 126 32 8 262 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0CZ31 2.15e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 2.15e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1J8E4 2.31e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q48V78 2.62e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 2.62e-32 126 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q63GR8 3.14e-32 125 31 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q89LP2 3.34e-32 125 32 7 264 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1JNE0 3.76e-32 125 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 3.76e-32 125 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q2SY12 4.29e-32 125 32 7 278 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S19 4.81e-32 125 32 7 280 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 4.81e-32 125 32 7 280 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 4.81e-32 125 32 7 280 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q0BH79 4.96e-32 125 33 7 278 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1JII9 9.11e-32 125 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P2K6 1.18e-31 124 29 9 319 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q134N9 1.67e-31 124 32 6 250 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q04DA7 1.82e-31 124 29 7 277 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8E3S0 2.22e-31 124 29 11 323 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q8ELA5 3.07e-31 123 31 8 271 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0KDG3 3.75e-31 123 30 7 262 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8DY54 5.31e-31 122 28 10 318 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 5.31e-31 122 28 10 318 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6A6X6 7.78e-31 122 29 5 257 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q81VM2 7.82e-31 122 30 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q6N9W0 7.87e-31 122 30 5 247 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8NWT5 8.24e-31 120 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q8ELQ6 9.92e-31 122 31 7 263 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q07LR5 1.12e-30 122 30 7 265 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
Q8Y0X3 1.18e-30 122 33 9 263 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6G9I0 1.33e-30 119 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 1.33e-30 119 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 1.33e-30 119 30 5 260 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 1.33e-30 119 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
Q74IV9 1.38e-30 121 30 7 263 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6D3Q6 4.01e-30 120 31 9 271 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5FKL2 4.09e-30 120 29 7 265 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q63H29 5.68e-30 120 29 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q6GH27 5.85e-30 117 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q8Y4L8 8.88e-30 119 31 8 288 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q46Y69 1.1e-29 119 31 7 259 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3JHC9 1.15e-29 120 32 10 285 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q73F11 1.55e-29 119 30 9 286 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q831K6 1.8e-29 118 30 7 270 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q0BMC9 2.13e-29 118 31 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 2.13e-29 118 31 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q8NSN2 2.68e-29 118 30 9 283 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q03Z27 2.77e-29 118 28 6 277 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q928L8 3.24e-29 117 31 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4KKK8 3.31e-29 117 30 7 258 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q03A07 3.37e-29 117 31 6 267 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q63NI4 3.65e-29 118 32 10 285 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q93DA2 4.42e-29 117 28 5 271 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q71X09 5.92e-29 117 30 8 288 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q2NRN5 5.93e-29 117 30 10 296 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q21BU8 6.47e-29 117 33 7 248 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q7A5Q8 7.19e-29 114 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 7.19e-29 114 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q62B84 8.11e-29 117 32 10 285 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q9K789 1e-28 116 31 6 262 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8FV85 1.09e-28 117 30 7 265 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.09e-28 117 30 7 265 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.09e-28 117 30 7 265 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.09e-28 117 30 7 265 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q3J1N0 1.26e-28 116 30 7 271 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8YA75 1.3e-28 116 29 7 267 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q81IZ6 1.3e-28 116 29 7 262 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2YXY9 1.57e-28 114 30 5 260 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q724C0 1.8e-28 115 29 7 267 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q49W48 1.93e-28 115 29 9 284 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5WJP0 1.95e-28 115 29 6 265 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q043Y8 2.13e-28 115 29 7 263 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q3KK97 2.44e-28 115 30 9 259 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
O32169 3.06e-28 115 28 4 266 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q8DRF9 3.24e-28 115 29 6 270 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q92EZ6 3.72e-28 114 29 7 267 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q14H97 3.75e-28 115 30 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q1IGZ0 3.95e-28 114 28 6 260 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q5NFU5 4.03e-28 115 30 7 271 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q9S4Z0 5.25e-28 114 31 8 240 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q97T09 5.68e-28 114 29 6 270 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q88RL5 5.82e-28 114 30 7 266 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q6G2E2 7.44e-28 114 31 8 251 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q12B04 8.31e-28 114 30 4 260 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5WDP1 1.14e-27 113 29 7 275 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q48PU6 1.57e-27 113 29 8 259 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8ENU2 1.76e-27 113 29 6 262 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0I5E9 1.93e-27 113 30 6 259 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q8P4S7 2.04e-27 112 31 7 245 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 2.04e-27 112 31 7 245 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q0SFY5 2.26e-27 112 31 9 264 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q9CIN4 3.03e-27 112 26 7 284 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q65VG9 3.45e-27 112 30 8 265 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
D8KFN1 3.56e-27 112 28 9 283 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 3.56e-27 112 28 9 283 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q2RWA3 3.68e-27 112 30 7 259 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q4KK46 4.43e-27 112 31 6 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6F9P2 5.05e-27 112 26 5 263 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q92LX3 5.08e-27 112 31 7 247 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q032A0 7.08e-27 112 28 9 283 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
O26096 7.35e-27 111 31 6 238 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FRX8 7.66e-27 111 30 8 264 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q2YVT7 1.19e-26 110 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8CTB2 1.23e-26 110 29 7 276 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q65F80 1.5e-26 110 29 8 267 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5YRD1 1.76e-26 110 31 6 246 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q88HL1 1.77e-26 108 31 5 259 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2RS21 2.14e-26 108 29 4 258 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q88WA5 2.15e-26 110 30 7 257 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4ZZK0 2.18e-26 110 30 7 259 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
Q21XK2 2.25e-26 110 28 7 286 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7A7E3 2.29e-26 110 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 2.29e-26 110 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
P16678 2.36e-26 108 30 6 265 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q87UN4 2.5e-26 109 29 8 259 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2KVK2 2.89e-26 110 28 6 263 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q1DDP4 2.96e-26 109 31 7 265 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q8PGE8 3.09e-26 109 30 7 245 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q4ZZR8 3.12e-26 109 29 8 259 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q6N798 3.33e-26 110 31 10 284 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8NY21 3.34e-26 109 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 3.34e-26 109 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q65M34 3.59e-26 109 29 6 255 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6D5H7 3.6e-26 109 30 8 263 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6GIH9 3.92e-26 109 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q2YWP2 4.34e-26 109 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5HQQ9 4.39e-26 109 29 7 274 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9L1C3 4.54e-26 109 31 8 266 3 metN Methionine import ATP-binding protein MetN Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8NXH5 5.11e-26 108 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 5.11e-26 108 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 5.11e-26 108 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 5.11e-26 108 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 5.11e-26 108 30 8 273 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q6ME20 5.43e-26 108 32 9 264 3 metN Methionine import ATP-binding protein MetN Protochlamydia amoebophila (strain UWE25)
Q9I1C8 5.85e-26 109 30 9 270 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6HBS0 6.13e-26 108 29 6 263 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q3BNZ3 6.23e-26 108 30 7 245 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0AU85 6.59e-26 108 31 9 271 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q72Y96 7.51e-26 108 30 6 256 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q631Y4 7.74e-26 108 29 6 263 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q6GJL2 8.06e-26 108 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q81XL3 8.14e-26 108 30 6 256 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q9HT70 8.27e-26 108 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 8.27e-26 108 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1CR30 9.94e-26 108 30 6 238 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q815Y7 1.1e-25 108 30 6 256 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q88UV2 1.13e-25 108 30 8 259 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q13LD8 1.21e-25 108 30 8 261 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q7CHF8 1.23e-25 107 29 6 261 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 1.23e-25 107 29 6 261 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 1.23e-25 107 29 6 261 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 1.23e-25 107 29 6 261 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q67SV5 1.32e-25 107 30 6 248 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q9PF03 1.32e-25 107 31 7 240 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q02ME3 1.35e-25 108 30 7 249 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9A502 1.36e-25 107 33 7 248 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q44613 1.39e-25 105 31 5 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7N8M2 1.57e-25 107 31 7 256 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q4L4R9 1.6e-25 107 27 8 276 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
Q7A6M2 1.6e-25 107 29 8 273 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 1.6e-25 107 29 8 273 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q87AL9 1.61e-25 107 30 7 242 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P0AAI0 1.66e-25 106 28 7 266 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 1.66e-25 106 28 7 266 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 1.66e-25 106 28 7 266 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5HIL5 1.81e-25 107 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 1.81e-25 107 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 1.81e-25 107 28 7 275 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q4JTG9 1.91e-25 108 29 8 268 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q83J78 2e-25 105 30 6 258 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q827Y0 3.16e-25 107 30 7 271 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q48PN3 3.44e-25 107 30 6 256 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A3DJK5 3.71e-25 105 30 6 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q1B677 4.05e-25 106 27 5 271 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q17VE0 4.11e-25 106 28 7 259 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q5E715 9.23e-25 105 27 7 273 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87RS1 9.42e-25 105 27 9 287 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0SZJ4 9.43e-25 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q6FAN3 1.03e-24 105 30 9 261 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4QMH4 1.05e-24 105 29 8 267 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q8X5U1 1.06e-24 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
Q1R5D9 1.07e-24 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 1.07e-24 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1WVG9 1.08e-24 105 28 7 267 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q9ZJ34 1.4e-24 105 29 6 238 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q57T09 1.65e-24 105 28 5 277 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
P33593 1.66e-24 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q8FCN0 1.66e-24 103 30 6 258 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2P7S3 1.67e-24 104 29 7 245 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q53I83 2.08e-24 105 32 8 256 3 metN Methionine import ATP-binding protein MetN Streptomyces griseus
P44785 2.51e-24 104 28 8 267 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5H503 2.81e-24 104 29 7 247 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q7VM95 2.85e-24 104 25 12 335 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3YW49 2.89e-24 102 29 5 258 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q8RFN2 3.05e-24 103 30 7 246 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7VV72 3.06e-24 104 28 9 287 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 3.06e-24 104 28 9 287 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 3.06e-24 104 28 9 287 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q97EK9 3.14e-24 103 30 9 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9KTJ5 3.45e-24 104 27 8 279 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q492R2 3.49e-24 101 32 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Blochmanniella pennsylvanica (strain BPEN)
Q5PID0 3.5e-24 103 28 5 277 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPK4 3.87e-24 104 31 9 261 1 osmV Osmoprotectant import ATP-binding protein OsmV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q31VE7 4.05e-24 102 29 5 258 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
Q8CRI7 4.96e-24 102 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q895C4 5.24e-24 103 29 8 238 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q5HM28 5.43e-24 102 26 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8ZRM9 6.93e-24 103 27 5 277 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32AQ2 7.41e-24 101 29 6 258 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q7MN25 8.09e-24 103 26 7 273 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q6GEL4 8.68e-24 102 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q8Z990 9.18e-24 102 28 5 277 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q8DFC3 9.31e-24 102 26 7 273 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q1BR30 9.92e-24 103 29 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 9.92e-24 103 29 9 290 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q6D1C4 1.04e-23 102 29 7 270 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87UV4 1.48e-23 102 29 7 257 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8YCN8 1.81e-23 100 29 6 260 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 1.81e-23 100 29 6 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 1.81e-23 100 29 6 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
Q0TLD2 1.85e-23 102 27 5 279 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q39AT4 2.11e-23 102 30 9 275 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q32JQ8 2.2e-23 102 27 5 277 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q1CFH7 2.24e-23 102 27 9 298 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 2.24e-23 102 27 9 298 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 2.24e-23 102 27 9 298 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
A0LM36 2.5e-23 104 30 5 220 3 macB Macrolide export ATP-binding/permease protein MacB Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3Z5F8 2.79e-23 101 27 5 277 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 2.79e-23 101 27 5 277 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 2.79e-23 101 27 5 277 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 2.79e-23 101 27 5 277 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
P30750 2.88e-23 101 27 5 277 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
P36638 3.16e-23 100 27 7 266 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6LN52 3.16e-23 101 27 7 279 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q20ZP0 3.17e-23 100 31 8 242 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q6AE21 3.2e-23 101 28 7 252 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q2RS22 3.28e-23 100 31 7 266 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q04B25 3.51e-23 101 28 9 290 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAN9 3.8e-23 101 28 9 290 3 metN Methionine import ATP-binding protein MetN Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q2YYM5 4.36e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2RPB4 4.49e-23 103 30 7 242 3 macB Macrolide export ATP-binding/permease protein MacB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7A088 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 4.49e-23 100 26 4 227 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 4.49e-23 100 26 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q4L884 4.62e-23 100 26 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q325U1 4.89e-23 100 27 5 277 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q83MC5 4.99e-23 100 27 5 277 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 4.99e-23 100 27 5 277 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q58206 5.26e-23 98 30 7 243 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8FVM9 6.3e-23 99 28 5 260 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q3KJS6 7.33e-23 100 29 6 246 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q7M816 8.06e-23 99 28 5 228 3 metN Methionine import ATP-binding protein MetN Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q1WSB9 9.24e-23 99 25 4 236 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q8PC11 9.93e-23 100 28 8 281 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q49ZD9 1.26e-22 99 24 5 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2IYS5 1.59e-22 98 31 7 239 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q8X4L6 2.09e-22 97 29 5 245 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
P55662 2.21e-22 97 25 7 257 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q667L9 2.54e-22 99 26 9 298 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q38WL5 2.98e-22 99 29 6 240 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q8CQS7 3.01e-22 98 25 7 276 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 3.01e-22 98 25 7 276 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O34992 3.1e-22 99 27 6 257 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q8NQU4 3.44e-22 97 28 8 250 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q45460 5.08e-22 98 27 8 295 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q0B6I6 5.68e-22 98 29 9 275 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q890R3 5.94e-22 97 29 7 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q8U7G2 5.99e-22 98 28 8 273 3 metN Methionine import ATP-binding protein MetN Agrobacterium fabrum (strain C58 / ATCC 33970)
A0PXX8 6.38e-22 97 27 9 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q88ZZ2 6.59e-22 99 30 9 249 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 1.23e-10 65 22 7 255 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88RB3 7.42e-22 98 31 8 244 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KHT9 7.7e-22 98 27 7 280 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 7.7e-22 98 27 7 280 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q1IGN4 8.03e-22 97 30 6 241 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q1R0Z6 8.75e-22 96 29 7 247 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q18C09 9.12e-22 97 27 8 241 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q9CK97 1.05e-21 97 28 7 257 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
A0A0H3JT74 1.08e-21 95 29 6 238 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HV18 1.09e-21 97 25 7 265 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 1.09e-21 97 25 7 265 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q1M8E0 1.26e-21 97 31 6 245 3 metN Methionine import ATP-binding protein MetN Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8FVN0 1.49e-21 95 29 5 237 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q31VE6 1.54e-21 95 29 5 252 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q8YCN7 1.58e-21 95 29 5 237 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 1.58e-21 95 29 5 237 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 1.58e-21 95 29 5 237 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q2FVF1 1.94e-21 94 29 6 238 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q24QI5 2.01e-21 96 27 8 268 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q2JLH7 2.23e-21 95 31 6 228 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q32AQ1 2.45e-21 94 29 5 252 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
P75551 2.78e-21 98 34 1 137 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75551 9.98e-09 60 30 3 115 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q045Z7 2.89e-21 95 26 6 250 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1R5D8 3.06e-21 94 29 5 252 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 3.06e-21 94 29 5 252 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 3.06e-21 94 29 5 252 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5ZUG5 3.27e-21 95 30 8 238 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q07PZ0 3.9e-21 94 30 7 239 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q5WVL8 3.99e-21 95 30 8 238 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q74L61 4.47e-21 94 25 8 268 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q98DA2 4.57e-21 95 31 8 259 3 metN Methionine import ATP-binding protein MetN Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q67JX4 5.22e-21 94 29 10 256 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P54537 5.23e-21 93 24 6 245 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q6KHL1 5.25e-21 94 28 9 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P47326 5.44e-21 97 34 1 137 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47326 7.39e-08 57 28 1 107 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q58639 5.7e-21 97 29 8 237 3 MJ1242 Uncharacterized ABC transporter ATP-binding protein MJ1242 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58639 2.5e-10 65 20 7 295 3 MJ1242 Uncharacterized ABC transporter ATP-binding protein MJ1242 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P17328 5.85e-21 95 27 6 261 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KGD6 6.14e-21 94 28 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1QVQ7 6.32e-21 95 29 10 271 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2K284 7.15e-21 95 31 6 247 3 metN Methionine import ATP-binding protein MetN Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5X484 7.58e-21 94 31 8 232 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
P33594 8.92e-21 93 29 5 245 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q83F44 1.06e-20 94 28 6 253 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q3YW48 1.15e-20 93 29 5 252 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q7M8M4 1.28e-20 93 29 7 246 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O34392 1.39e-20 92 29 8 249 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q7VI92 1.44e-20 94 27 7 251 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P14175 1.52e-20 94 26 6 261 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q5UW69 1.68e-20 92 30 5 228 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q032D0 1.75e-20 92 31 6 220 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q83J77 2.37e-20 92 30 4 225 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q32EX7 2.45e-20 91 31 6 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q8DQH4 3.22e-20 90 30 10 242 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 3.22e-20 90 30 10 242 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q0SZJ3 3.68e-20 91 30 4 225 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q18CI9 3.76e-20 92 29 6 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
P77795 4.66e-20 92 28 7 257 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
P75957 5.73e-20 90 31 6 225 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q5E0B3 6.58e-20 90 29 6 226 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9CIQ6 6.86e-20 90 30 6 220 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
P27675 7.1e-20 90 26 8 252 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q18CJ0 9.36e-20 90 25 6 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q3KBH4 9.5e-20 92 25 8 306 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q6WB63 9.88e-20 90 31 8 239 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
P63354 1.11e-19 91 28 6 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 1.11e-19 91 28 6 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P39456 1.19e-19 89 26 11 273 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
P46920 1.23e-19 92 28 7 262 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
E0SCY1 1.23e-19 92 27 5 251 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q3A558 1.47e-19 89 27 6 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8D3Z9 1.68e-19 92 28 8 251 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 1.73e-08 59 22 7 249 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q3Z300 1.71e-19 89 30 5 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 1.71e-19 89 30 5 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 1.71e-19 89 30 5 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 1.71e-19 89 30 5 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9PDN2 1.85e-19 90 26 6 263 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
O34979 1.93e-19 89 28 7 238 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q0C1C3 2.18e-19 88 27 6 243 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q03PY6 2.2e-19 89 25 4 226 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5YZY9 2.24e-19 90 26 5 248 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q4KBU0 2.35e-19 90 31 8 244 3 metN3 Methionine import ATP-binding protein MetN 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7MFH3 2.42e-19 92 28 8 251 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 9.8e-09 60 22 7 249 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q8GEH7 2.65e-19 90 28 7 242 3 metN Methionine import ATP-binding protein MetN Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q8DRS0 2.83e-19 89 28 7 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q87DT9 3.42e-19 90 26 6 261 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q7N3A6 3.71e-19 88 28 5 226 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5X2Z8 4.34e-19 87 27 6 235 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q8PNN4 4.47e-19 89 27 7 253 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q8RFV0 4.82e-19 87 28 8 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P33360 4.9e-19 89 26 7 249 1 yehX Glycine betaine uptake system ATP-binding protein YehX Escherichia coli (strain K12)
Q39GY8 5e-19 91 27 16 361 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39GY8 9.24e-06 50 24 6 219 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A3CRB8 5.07e-19 88 27 9 262 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q8DWR4 5.41e-19 88 27 9 274 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 5.41e-19 88 27 9 274 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 5.41e-19 88 27 9 274 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8PYH5 5.44e-19 89 26 6 232 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q47RE8 6.34e-19 89 31 8 242 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q9YG51 6.49e-19 87 25 7 250 3 pstB Phosphate import ATP-binding protein PstB Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q5ZT78 7.63e-19 87 27 6 235 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8R7Y5 7.75e-19 88 27 7 228 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P0A9S0 7.88e-19 87 31 8 225 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 7.88e-19 87 31 8 225 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 7.88e-19 87 31 8 225 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 7.88e-19 87 31 8 225 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
Q9RR46 8.01e-19 89 26 7 255 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q8TQ05 8.33e-19 90 28 4 226 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 2.9e-12 70 22 6 245 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q3M5J9 8.38e-19 87 29 7 228 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9V1Q4 1.04e-18 87 26 8 256 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q38UU0 1.07e-18 88 26 5 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
A0LUE6 1.28e-18 89 26 6 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q2NHA1 1.32e-18 87 25 9 249 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
P70970 1.37e-18 87 25 4 228 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q8KFE9 1.4e-18 90 27 8 251 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03670
Feature type CDS
Gene sapD
Product putrescine export ABC transporter ATP-binding protein SapD
Location 779465 - 780457 (strand: -1)
Length 993 (nucleotides) / 330 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1076
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter
PF08352 Oligopeptide/dipeptide transporter, C-terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4170 Defense mechanisms (V) V ABC-type antimicrobial peptide export system, ATPase component SapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19229 cationic peptide transport system ATP-binding protein Cationic antimicrobial peptide (CAMP) resistance
ABC transporters
-

Protein Sequence

MPLLDIRNLTIEFMTAAGPVKAVDRVTLSLTEGEFRGLAGESGSGKSLIAKAISGVTKDNLRVTADRFRFNDIDLLKLSPRQRRKVIGHNVSMIFQEPQSCLDPSENIGKQLIQAIPGWTYKGRWWQRFNWRKRRAIELLHRVGIKDHKDVMGNYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPDTQAQIFRLLTRLNQNNNMTILLISHDLQMMSQLVDRIHVLYCGQTVESAEPKDLLLKPHHPYTQALMRAIPDFEKALAHKCRLNTLPGAIPSLEHLPVGCRLGPRCPYAQKICIDAPRLRTIKNRSFACHFPLNMEDV

Flanking regions ( +/- flanking 50bp)

AATCTGCTCGGCACCGGGTTACAGCGCGCAATTAATGCGGGGGTGGAATAATGCCGTTACTGGATATCCGCAATTTAACCATCGAATTTATGACTGCCGCCGGTCCGGTAAAAGCGGTGGATCGCGTGACATTATCCCTTACCGAGGGTGAGTTTCGCGGGCTGGCGGGTGAATCAGGATCGGGTAAAAGCCTGATTGCCAAAGCGATTTCCGGTGTCACCAAGGATAATTTGCGCGTCACGGCAGACCGTTTCCGTTTTAATGATATTGACCTGCTGAAATTATCGCCCCGCCAGCGCCGCAAGGTGATCGGGCACAATGTGTCGATGATTTTTCAGGAGCCGCAATCCTGTCTTGATCCGTCAGAAAATATCGGCAAACAGCTGATTCAGGCAATTCCGGGCTGGACTTATAAAGGCCGCTGGTGGCAGCGGTTTAACTGGCGTAAGCGCCGTGCTATTGAGTTGCTGCACCGCGTCGGTATCAAAGATCATAAAGATGTGATGGGTAATTATCCCTATGAACTGACCGAAGGTGAATGTCAGAAGGTGATGATTGCCATCGCGCTGGCAAATCAGCCGCGCCTGCTGATCGCCGATGAGCCGACCAACGCCATGGAGCCGGATACCCAGGCGCAGATTTTCCGCCTGCTCACCCGTCTGAATCAGAATAATAATATGACTATTTTGCTTATCAGTCATGATTTGCAGATGATGAGCCAACTGGTAGACCGCATCCATGTGCTCTATTGCGGGCAAACCGTGGAGAGTGCCGAGCCGAAAGATTTGCTGCTCAAGCCTCACCATCCGTACACCCAGGCGCTGATGCGGGCGATACCTGATTTTGAAAAAGCCCTCGCGCACAAGTGCCGGCTGAATACATTACCGGGAGCTATTCCTTCACTGGAACACCTGCCGGTCGGCTGCCGTCTGGGACCGCGCTGCCCGTATGCACAAAAGATATGTATTGATGCGCCGCGTCTGCGCACCATAAAAAACCGCAGCTTTGCCTGCCACTTCCCGCTGAATATGGAGGATGTGTAATGCCGGGTCCTCTGCTGGAAGTCAAAAATCTGAGTAAAACCTTTCATTAC