Homologs in group_1064

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05575 FBDBKF_05575 68.9 Morganella morganii S1 tpx thiol peroxidase
EHELCC_12015 EHELCC_12015 68.9 Morganella morganii S2 tpx thiol peroxidase
NLDBIP_12355 NLDBIP_12355 68.9 Morganella morganii S4 tpx thiol peroxidase
LHKJJB_12215 LHKJJB_12215 68.9 Morganella morganii S3 tpx thiol peroxidase
HKOGLL_10830 HKOGLL_10830 68.9 Morganella morganii S5 tpx thiol peroxidase
F4V73_RS03730 F4V73_RS03730 70.1 Morganella psychrotolerans tpx thiol peroxidase

Distribution of the homologs in the orthogroup group_1064

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1064

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZE42 2.25e-90 263 73 0 167 3 tpx Thiol peroxidase Yersinia pestis
P0A865 2.92e-86 253 71 0 167 3 tpx Thiol peroxidase Shigella flexneri
P0A866 2.92e-86 253 71 0 167 3 tpx Thiol peroxidase Shigella dysenteriae
P0A862 2.92e-86 253 71 0 167 1 tpx Thiol peroxidase Escherichia coli (strain K12)
P0A863 2.92e-86 253 71 0 167 3 tpx Thiol peroxidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A864 2.92e-86 253 71 0 167 3 tpx Thiol peroxidase Escherichia coli O157:H7
Q8ZP65 4e-84 248 70 0 167 3 tpx Thiol peroxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7A8 4.09e-83 245 70 0 167 3 tpx Thiol peroxidase Salmonella typhi
P57668 3.58e-77 230 70 0 163 3 tpx Thiol peroxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q57549 9.45e-75 224 66 0 162 1 tpx Thiol peroxidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8XVP0 5.32e-73 219 66 0 163 3 tpx Thiol peroxidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P57880 1.74e-70 213 61 0 163 3 tpx Thiol peroxidase Pasteurella multocida (strain Pm70)
Q8KED5 2.9e-66 202 61 0 162 3 tpx Thiol peroxidase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8NRG3 1.82e-59 185 55 1 163 3 tpx Thiol peroxidase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FQH8 4.08e-57 179 55 1 160 3 tpx Thiol peroxidase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P9WG35 1.84e-56 177 55 2 163 1 tpx Thiol peroxidase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG34 1.84e-56 177 55 2 163 3 tpx Thiol peroxidase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66953 1.84e-56 177 55 2 163 1 tpx Thiol peroxidase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8DUK3 6.36e-52 166 51 1 162 3 tpx Thiol peroxidase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P42366 3.72e-51 164 50 1 162 3 tpx Thiol peroxidase Streptococcus gordonii
P31308 3.97e-51 164 50 1 162 1 tpx Thiol peroxidase Streptococcus sanguinis
P31307 7.64e-50 160 48 1 162 3 tpx Thiol peroxidase Streptococcus parasanguinis
P0C6P9 9.92e-49 157 47 0 162 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8F7T2 2.85e-48 157 49 1 158 3 tpx Thiol peroxidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NR4 2.85e-48 157 49 1 158 3 tpx Thiol peroxidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5F3A2 2.43e-47 154 46 0 162 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8E536 1.23e-46 152 45 1 158 3 tpx Thiol peroxidase Streptococcus agalactiae serotype III (strain NEM316)
Q8DZH0 5.49e-46 150 45 1 158 3 tpx Thiol peroxidase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4M6 6.07e-46 150 48 1 156 3 tpx Thiol peroxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C2J8 6.07e-46 150 48 1 156 1 tpx Thiol peroxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JB8 6.07e-46 150 48 1 156 3 tpx Thiol peroxidase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q6GFZ4 6.19e-46 150 46 2 164 3 tpx Thiol peroxidase Staphylococcus aureus (strain MRSA252)
Q8NW51 8.31e-46 150 46 2 164 3 tpx Thiol peroxidase Staphylococcus aureus (strain MW2)
Q6G8L4 8.31e-46 150 46 2 164 3 tpx Thiol peroxidase Staphylococcus aureus (strain MSSA476)
Q5HF61 8.31e-46 150 46 2 164 3 tpx Thiol peroxidase Staphylococcus aureus (strain COL)
P99146 1.22e-45 150 46 2 164 1 tpx Thiol peroxidase Staphylococcus aureus (strain N315)
P66954 1.22e-45 150 46 2 164 3 tpx Thiol peroxidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q4L754 2.05e-45 149 45 2 164 3 tpx Thiol peroxidase Staphylococcus haemolyticus (strain JCSC1435)
Q8EPB7 8.53e-44 145 43 1 162 3 tpx Thiol peroxidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q71Z84 1.42e-43 144 44 1 156 3 tpx Thiol peroxidase Listeria monocytogenes serotype 4b (strain F2365)
Q92BC5 2.22e-43 144 44 1 156 3 tpx Thiol peroxidase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y6U8 4.76e-43 143 44 1 156 3 tpx Thiol peroxidase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P80864 7.32e-43 143 44 1 164 1 tpx Thiol peroxidase Bacillus subtilis (strain 168)
Q49YE4 4.12e-42 141 40 2 164 3 tpx Thiol peroxidase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CS58 3.84e-39 133 39 2 164 3 tpx Thiol peroxidase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNJ2 3.84e-39 133 39 2 164 3 tpx Thiol peroxidase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K813 2.95e-37 129 42 1 155 3 tpx Thiol peroxidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9ZKE7 4.22e-37 128 41 0 165 3 tpx Thiol peroxidase Helicobacter pylori (strain J99 / ATCC 700824)
O25151 1.97e-36 126 40 0 165 1 tpx Thiol peroxidase Helicobacter pylori (strain ATCC 700392 / 26695)
O66780 4.11e-34 120 40 1 167 1 tpx Thiol peroxidase Aquifex aeolicus (strain VF5)
Q9PPE0 5.3e-34 120 43 2 154 3 tpx Thiol peroxidase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q97E14 2.31e-33 119 42 2 160 3 tpx Thiol peroxidase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9Z0V6 2.15e-06 49 28 6 160 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
Q5REY3 4.72e-06 48 28 6 160 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
P30048 4.72e-06 48 28 6 160 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
P42365 6.74e-06 44 51 0 47 1 tpx Thiol peroxidase (Fragment) Streptococcus pneumoniae
P20108 8.88e-06 47 28 6 160 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
A0A0K3AUJ9 1e-05 47 30 5 135 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
P35705 1.15e-05 47 28 7 160 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
Q9LU86 1.4e-05 47 29 6 154 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
P23161 2.03e-05 46 23 6 159 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
P9WIE1 3.26e-05 45 29 3 137 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 3.26e-05 45 29 3 137 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q17172 0.000549 42 32 2 85 2 tsa-2 Peroxiredoxin 2 Brugia malayi
P44411 0.000895 41 25 5 154 3 bcp Putative peroxiredoxin bcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06605
Feature type CDS
Gene tpx
Product thiol peroxidase
Location 1447184 - 1447687 (strand: 1)
Length 504 (nucleotides) / 167 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1064
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08534 Redoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2077 Posttranslational modification, protein turnover, chaperones (O) O Peroxiredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11065 thioredoxin-dependent peroxiredoxin [EC:1.11.1.24] - -

Protein Sequence

MAHQVTLQGNAVTLAGNFPTVGQKAADFSLVGKDLNDVSLAQFAGKRKVLNIFPSVDTGVCAASVRQFNKVANELNNTVVLCISADLPFAQARFCGAEGLDNVVTLSTMRGAEFKENYGVAITSGPLAGLTSRAVIVLDESNNVIYTQLVDEITTEPNYDAALAVLK

Flanking regions ( +/- flanking 50bp)

AATTTAGTATTAATAATGGTTAGTTCAATAAGTAACAAAGGAGAACAACAATGGCACATCAAGTGACTTTACAAGGTAATGCGGTGACTTTAGCTGGAAATTTCCCCACTGTAGGCCAAAAGGCAGCCGATTTTTCTTTAGTGGGTAAAGATCTAAATGATGTTTCTTTAGCGCAATTTGCCGGCAAACGTAAAGTATTAAATATTTTCCCAAGTGTAGATACTGGTGTTTGTGCAGCGAGTGTTCGCCAATTTAATAAAGTCGCCAACGAATTAAATAATACCGTTGTACTGTGTATTTCAGCAGATTTACCTTTTGCTCAAGCGCGTTTTTGCGGTGCTGAAGGTTTAGATAATGTTGTCACATTATCAACAATGCGTGGTGCGGAATTTAAAGAAAACTATGGTGTCGCGATTACGTCAGGTCCTTTAGCGGGATTAACTAGCCGTGCTGTGATTGTACTTGATGAAAGTAACAACGTTATCTACACCCAATTAGTTGATGAAATCACCACTGAACCTAATTATGACGCAGCATTAGCTGTACTAAAATAATTGACAATAACGTTATTCATACCGAGTAATGTAAAAAACAAACGGGCTAA