Homologs in group_1064

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05575 FBDBKF_05575 85.6 Morganella morganii S1 tpx thiol peroxidase
EHELCC_12015 EHELCC_12015 85.6 Morganella morganii S2 tpx thiol peroxidase
NLDBIP_12355 NLDBIP_12355 85.6 Morganella morganii S4 tpx thiol peroxidase
LHKJJB_12215 LHKJJB_12215 85.6 Morganella morganii S3 tpx thiol peroxidase
HKOGLL_10830 HKOGLL_10830 85.6 Morganella morganii S5 tpx thiol peroxidase
PMI_RS06605 PMI_RS06605 70.1 Proteus mirabilis HI4320 tpx thiol peroxidase

Distribution of the homologs in the orthogroup group_1064

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1064

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZE42 1.85e-80 238 67 0 167 3 tpx Thiol peroxidase Yersinia pestis
Q8ZP65 9.36e-80 236 67 0 167 3 tpx Thiol peroxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7A8 9.54e-79 234 66 0 167 3 tpx Thiol peroxidase Salmonella typhi
P0A865 5.57e-78 232 65 0 167 3 tpx Thiol peroxidase Shigella flexneri
P0A866 5.57e-78 232 65 0 167 3 tpx Thiol peroxidase Shigella dysenteriae
P0A862 5.57e-78 232 65 0 167 1 tpx Thiol peroxidase Escherichia coli (strain K12)
P0A863 5.57e-78 232 65 0 167 3 tpx Thiol peroxidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A864 5.57e-78 232 65 0 167 3 tpx Thiol peroxidase Escherichia coli O157:H7
P57668 1.87e-75 225 69 0 162 3 tpx Thiol peroxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57880 1.19e-70 213 61 0 162 3 tpx Thiol peroxidase Pasteurella multocida (strain Pm70)
Q57549 1.54e-70 213 63 0 163 1 tpx Thiol peroxidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8XVP0 1.21e-67 206 63 0 163 3 tpx Thiol peroxidase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8KED5 1.63e-59 185 54 0 163 3 tpx Thiol peroxidase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8NRG3 3.98e-58 181 56 1 161 3 tpx Thiol peroxidase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P9WG35 1.96e-53 169 54 2 162 1 tpx Thiol peroxidase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG34 1.96e-53 169 54 2 162 3 tpx Thiol peroxidase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66953 1.96e-53 169 54 2 162 1 tpx Thiol peroxidase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8FQH8 7.68e-53 168 52 1 163 3 tpx Thiol peroxidase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P31308 1.44e-49 160 50 1 159 1 tpx Thiol peroxidase Streptococcus sanguinis
P42366 1.66e-49 159 50 1 159 3 tpx Thiol peroxidase Streptococcus gordonii
A5F3A2 1.27e-47 155 46 0 163 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0C6P9 2.56e-47 154 45 0 163 3 tpx Thiol peroxidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8F7T2 2.25e-45 149 50 1 157 3 tpx Thiol peroxidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NR4 2.25e-45 149 50 1 157 3 tpx Thiol peroxidase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P31307 4.3e-44 146 45 1 159 3 tpx Thiol peroxidase Streptococcus parasanguinis
P0A4M6 9.54e-44 145 46 1 156 3 tpx Thiol peroxidase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0C2J8 9.54e-44 145 46 1 156 1 tpx Thiol peroxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JB8 9.54e-44 145 46 1 156 3 tpx Thiol peroxidase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8NW51 1.07e-42 142 45 2 163 3 tpx Thiol peroxidase Staphylococcus aureus (strain MW2)
Q6G8L4 1.07e-42 142 45 2 163 3 tpx Thiol peroxidase Staphylococcus aureus (strain MSSA476)
Q5HF61 1.07e-42 142 45 2 163 3 tpx Thiol peroxidase Staphylococcus aureus (strain COL)
Q6GFZ4 1.08e-42 142 45 2 163 3 tpx Thiol peroxidase Staphylococcus aureus (strain MRSA252)
P99146 1.8e-42 142 45 2 163 1 tpx Thiol peroxidase Staphylococcus aureus (strain N315)
P66954 1.8e-42 142 45 2 163 3 tpx Thiol peroxidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8E536 2.27e-42 141 40 1 159 3 tpx Thiol peroxidase Streptococcus agalactiae serotype III (strain NEM316)
Q8DUK3 2.44e-42 141 44 1 161 3 tpx Thiol peroxidase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8DZH0 1.2e-41 140 40 1 159 3 tpx Thiol peroxidase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P80864 2.63e-41 139 45 1 163 1 tpx Thiol peroxidase Bacillus subtilis (strain 168)
Q49YE4 1.14e-40 137 42 2 156 3 tpx Thiol peroxidase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8EPB7 2.67e-40 136 40 2 166 3 tpx Thiol peroxidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4L754 3.21e-40 136 41 2 163 3 tpx Thiol peroxidase Staphylococcus haemolyticus (strain JCSC1435)
Q92BC5 9.92e-40 135 43 1 155 3 tpx Thiol peroxidase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71Z84 8.19e-39 132 43 1 155 3 tpx Thiol peroxidase Listeria monocytogenes serotype 4b (strain F2365)
Q8CS58 1.31e-38 132 40 2 163 3 tpx Thiol peroxidase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNJ2 1.31e-38 132 40 2 163 3 tpx Thiol peroxidase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8Y6U8 1.38e-38 132 43 1 155 3 tpx Thiol peroxidase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O66780 2.2e-38 131 43 1 167 1 tpx Thiol peroxidase Aquifex aeolicus (strain VF5)
Q9ZKE7 6.1e-38 130 43 0 155 3 tpx Thiol peroxidase Helicobacter pylori (strain J99 / ATCC 700824)
O25151 2.5e-37 129 42 0 155 1 tpx Thiol peroxidase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9K813 2e-36 126 42 1 156 3 tpx Thiol peroxidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9PPE0 1.85e-34 122 46 2 156 3 tpx Thiol peroxidase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q97E14 1.95e-30 111 40 2 161 3 tpx Thiol peroxidase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O74887 4.81e-06 48 30 5 132 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WIE1 2.14e-05 45 28 4 135 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 2.14e-05 45 28 4 135 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9Z0V6 5.41e-05 45 27 6 154 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
A0A0K3AUJ9 5.69e-05 45 28 5 135 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
P35705 9.07e-05 44 29 5 119 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
Q8T6C4 0.000315 42 28 5 133 2 TPX Thioredoxin peroxidase Echinococcus granulosus
P42365 0.000321 40 47 0 44 1 tpx Thiol peroxidase (Fragment) Streptococcus pneumoniae
Q5REY3 0.000382 43 28 5 128 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
P20108 0.000455 42 27 5 128 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
P30048 0.000458 42 28 5 128 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
P19476 0.000589 42 28 5 141 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q8SS85 0.000823 41 28 1 90 1 ECU03_1190 Putative thioredoxin peroxidase Encephalitozoon cuniculi (strain GB-M1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03730
Feature type CDS
Gene tpx
Product thiol peroxidase
Location 791645 - 792148 (strand: -1)
Length 504 (nucleotides) / 167 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1064
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08534 Redoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2077 Posttranslational modification, protein turnover, chaperones (O) O Peroxiredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11065 thioredoxin-dependent peroxiredoxin [EC:1.11.1.24] - -

Protein Sequence

MTNTVKLQGNDVRVYGSFPHVGDKAAPFSLVTGELSDATLATYAGKRKILNIFPSVDTGVCATSVRKFNETAAKLSNAVVLCISADLPFAQARFCGAEGIENVVMLSTLRDPEFRENYGVGIGSGPLAGLCARAVVVLDEKDNVIYSQLVGEITEEPDYDSALNALK

Flanking regions ( +/- flanking 50bp)

CTGCTATTTTTAAATAAACAATTATGGGCTTCATTAAAAGGATAAAAAATATGACTAATACTGTAAAACTTCAGGGTAATGATGTACGGGTTTATGGTTCGTTCCCGCACGTTGGTGATAAAGCCGCACCCTTCAGCTTAGTGACCGGTGAACTGTCCGATGCCACCCTCGCCACGTATGCCGGAAAACGTAAAATCCTCAATATTTTCCCGAGTGTGGATACCGGTGTGTGTGCGACCTCTGTGCGCAAATTTAATGAAACAGCCGCAAAACTCAGTAATGCCGTTGTTTTATGTATCTCCGCTGATCTGCCTTTTGCTCAGGCGCGTTTCTGCGGCGCGGAAGGCATTGAAAATGTCGTGATGCTTTCCACCCTGCGCGACCCGGAGTTCCGTGAAAATTACGGCGTCGGGATTGGCAGCGGCCCGTTAGCCGGTCTGTGCGCCCGTGCGGTTGTGGTGCTGGATGAGAAAGATAATGTGATTTACAGCCAGCTCGTCGGCGAAATCACAGAAGAGCCGGATTATGACAGCGCGCTGAATGCACTGAAATAATTAGCTTTATATATACATATCCAACGTCATTCAAGATGCAGGAAGGCGGC