Homologs in group_223

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01245 FBDBKF_01245 62.7 Morganella morganii S1 leuE leucine efflux protein LeuE
EHELCC_00300 EHELCC_00300 62.7 Morganella morganii S2 leuE leucine efflux protein LeuE
NLDBIP_03160 NLDBIP_03160 62.7 Morganella morganii S4 leuE leucine efflux protein LeuE
LHKJJB_04675 LHKJJB_04675 62.7 Morganella morganii S3 leuE leucine efflux protein LeuE
HKOGLL_02370 HKOGLL_02370 62.7 Morganella morganii S5 leuE leucine efflux protein LeuE
F4V73_RS07285 F4V73_RS07285 64.6 Morganella psychrotolerans leuE leucine efflux protein LeuE
PMI_RS05970 PMI_RS05970 50.7 Proteus mirabilis HI4320 leuE leucine efflux protein LeuE

Distribution of the homologs in the orthogroup group_223

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_223

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQP8 1.84e-85 255 60 0 209 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 1.84e-85 255 60 0 209 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 1.84e-85 255 60 0 209 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 1.84e-85 255 60 0 209 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
Q1RAZ2 9.71e-82 245 59 2 210 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 9.71e-82 245 59 2 210 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 9.71e-82 245 59 2 210 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 9.71e-82 245 59 2 210 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
Q3Z2D8 1.6e-81 245 57 0 209 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 1.6e-81 245 57 0 209 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32FT6 1.85e-81 244 57 0 209 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
P76249 2e-81 244 57 0 209 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 2e-81 244 57 0 209 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
Q8XDS6 5.46e-81 243 57 0 209 3 leuE Leucine efflux protein Escherichia coli O157:H7
A8AHJ0 1.31e-80 243 57 0 209 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6T7N0 1.23e-74 227 55 0 209 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WB82 2.76e-73 224 56 0 207 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
Q321T8 5.39e-71 217 57 0 191 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
P38102 8.35e-68 210 52 3 214 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O05406 1.01e-17 81 29 5 200 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
Q9KVK7 4.68e-17 79 31 6 219 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P74343 1.34e-13 70 31 2 154 3 slr1627 Uncharacterized membrane protein slr1627 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P75693 4.07e-13 69 28 5 186 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)
P0AG37 2.75e-11 63 30 2 136 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 2.75e-11 63 30 2 136 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 2.75e-11 63 30 2 136 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 2.75e-11 63 30 2 136 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
Q8Z3B3 5.51e-11 63 28 4 195 3 rhtC Threonine efflux protein Salmonella typhi
Q9L6N7 5.63e-11 63 28 4 195 3 rhtC Threonine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57320 2.84e-10 61 29 4 189 3 HI_1307 Uncharacterized membrane protein HI_1307 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AG38 3.56e-10 60 27 4 195 1 rhtC Threonine efflux protein Escherichia coli (strain K12)
P0AG39 3.56e-10 60 27 4 195 3 rhtC Threonine efflux protein Escherichia coli O157:H7
Q8Z3B4 2.45e-09 58 30 2 133 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
Q9L6N6 3.34e-09 58 31 4 137 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P70775 0.000182 44 25 7 194 3 yggA Putative amino-acid transporter YggA Aeromonas salmonicida
Q8ZMX5 0.000742 42 25 10 198 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57L56 0.000742 42 25 10 198 3 eamB Cysteine/O-acetylserine efflux protein Salmonella choleraesuis (strain SC-B67)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06575
Feature type CDS
Gene leuE
Product leucine efflux protein LeuE
Location 1440196 - 1440864 (strand: 1)
Length 669 (nucleotides) / 222 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_223
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11250 leucine efflux protein - -

Protein Sequence

MYSKSMGVTVWLEQFGVLNIWTYLAGMFFIIIVPGPNSLYVLKTSASRGVGAGYRAALGVFIGDAILIFLAFIGVASVIKASPVLFTIVRFLGAFYLLYLGIKIIHANFFAKKQSHTETNCIQEHVFRKALTLSLTNPKAILFYISFFVQFIDFNYAHTGLSYLILASMLEAFSFVYLSFLIFGGVALARFFGSRKNIAKLGNGIVGLFFMGFATKLATLSS

Flanking regions ( +/- flanking 50bp)

TTTAAATTTTTCTGTTTCTCTTTATATAATAACAGGTCAAAGTTTATATCATGTACAGTAAAAGTATGGGGGTTACTGTGTGGCTTGAACAATTTGGAGTGCTCAATATTTGGACATATCTTGCGGGTATGTTCTTTATTATTATCGTCCCCGGCCCTAATTCCCTTTATGTGCTTAAAACCAGTGCATCAAGAGGAGTTGGTGCAGGTTATCGAGCCGCATTAGGGGTTTTTATTGGCGATGCTATCTTAATTTTCTTAGCATTTATCGGTGTGGCATCAGTTATTAAAGCCTCTCCTGTGCTTTTTACTATTGTCCGTTTCTTAGGTGCTTTTTATCTACTCTATCTCGGTATCAAAATTATTCATGCTAACTTCTTTGCCAAAAAGCAAAGCCATACTGAGACAAACTGTATTCAAGAACATGTATTTCGTAAGGCATTAACATTAAGCTTAACCAACCCCAAAGCGATTTTGTTTTATATCTCCTTTTTTGTGCAATTTATCGACTTTAACTATGCACATACTGGTTTATCCTACTTGATCTTAGCTTCTATGCTTGAAGCATTTAGCTTTGTTTATCTCTCTTTTCTTATTTTTGGTGGTGTAGCATTGGCGCGTTTCTTCGGTTCACGTAAAAATATCGCTAAACTGGGAAATGGTATTGTTGGGCTATTTTTTATGGGGTTTGCCACCAAACTTGCCACACTCTCCTCTTAAATAGACGTCCTTTAGTGACTTAAATAAGAGGCTGTTGTTATCAATAGCGA