Homologs in group_925

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05025 FBDBKF_05025 90.2 Morganella morganii S1 rsxA electron transport complex subunit RsxA
EHELCC_12565 EHELCC_12565 90.2 Morganella morganii S2 rsxA electron transport complex subunit RsxA
NLDBIP_12905 NLDBIP_12905 90.2 Morganella morganii S4 rsxA electron transport complex subunit RsxA
LHKJJB_12765 LHKJJB_12765 90.2 Morganella morganii S3 rsxA electron transport complex subunit RsxA
HKOGLL_11380 HKOGLL_11380 90.2 Morganella morganii S5 rsxA electron transport complex subunit RsxA
F4V73_RS05465 F4V73_RS05465 91.2 Morganella psychrotolerans rsxA electron transport complex subunit RsxA

Distribution of the homologs in the orthogroup group_925

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_925

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVZ5 8.68e-135 377 100 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Proteus mirabilis (strain HI4320)
Q7N4G1 1.19e-125 354 92 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MRW5 1.74e-120 342 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AH08 2.5e-120 341 88 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P65542 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65543 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella typhi
B4TV19 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella schwarzengrund (strain CVM19633)
B5BKB0 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella paratyphi A (strain AKU_12601)
C0Q506 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella paratyphi C (strain RKS4594)
A9N023 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIC1 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T596 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella newport (strain SL254)
B4THD6 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella heidelberg (strain SL476)
B5RAK0 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV00 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella enteritidis PT4 (strain P125109)
B5FIE5 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella dublin (strain CT_02021853)
Q57PH8 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella choleraesuis (strain SC-B67)
B5F6I8 3.08e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Salmonella agona (strain SL483)
B7LQP3 3.63e-120 341 88 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32FE6 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella dysenteriae serotype 1 (strain Sd197)
B2U2C6 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LEQ9 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain SMS-3-5 / SECEC)
B6IB62 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain SE11)
B7NB81 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A766 1.7e-119 339 87 0 193 1 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain K12)
B1IQC7 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A767 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THK0 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A0H0 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O9:H4 (strain HS)
B1XF92 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain K12 / DH10B)
C4ZY90 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0I4 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O8 (strain IAI1)
B7MVA5 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O81 (strain ED1a)
B7NU06 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z461 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A768 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O157:H7
B7L5I0 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain 55989 / EAEC)
B7URW8 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM87 1.7e-119 339 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JKN2 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CIY7 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8U8 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEC8 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pestis
B2K4K2 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C7K1 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHZ1 2.05e-119 339 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1RBG9 3.29e-119 338 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli (strain UTI89 / UPEC)
A1ABH2 3.29e-119 338 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O1:K1 / APEC
B7M9Y1 3.29e-119 338 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z1Y2 6.29e-119 337 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella sonnei (strain Ss046)
A1JM88 8.09e-119 337 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q83KY7 8.83e-119 337 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella flexneri
Q0T4F0 8.83e-119 337 87 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella flexneri serotype 5b (strain 8401)
Q320Y4 1.6e-118 337 86 0 193 3 rsxA Ion-translocating oxidoreductase complex subunit A Shigella boydii serotype 4 (strain Sb227)
A4TJ27 2.7e-118 336 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Yersinia pestis (strain Pestoides F)
A8GE02 3.37e-118 336 86 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Serratia proteamaculans (strain 568)
B5XWQ1 7.66e-118 335 86 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Klebsiella pneumoniae (strain 342)
A7MMM2 1.58e-115 329 84 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Cronobacter sakazakii (strain ATCC BAA-894)
Q2NSZ5 7.26e-114 325 82 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Sodalis glossinidius (strain morsitans)
B2VEQ1 2.96e-112 321 80 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9KT86 1.33e-111 319 79 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AKU6 4.27e-111 318 79 0 193 1 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MM81 6.49e-111 317 78 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio vulnificus (strain YJ016)
Q8D890 6.49e-111 317 78 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio vulnificus (strain CMCP6)
Q6D4W4 9.04e-111 317 82 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DH17 3.48e-110 315 81 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B6EGH7 7.92e-110 315 78 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Aliivibrio salmonicida (strain LFI1238)
Q15RL5 1.05e-109 314 80 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7MVC5 1.72e-109 313 78 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio campbellii (strain ATCC BAA-1116)
Q5E6B6 2.06e-109 313 78 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0KLJ2 2.22e-109 313 78 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5BDE5 4.01e-109 313 85 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Edwardsiella ictaluri (strain 93-146)
A4SNP5 6.16e-109 312 77 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Aeromonas salmonicida (strain A449)
B7VLT9 8.16e-107 307 82 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio atlanticus (strain LGP32)
A4Y6J0 6.77e-105 302 76 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KX79 7.89e-105 302 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella sp. (strain ANA-3)
Q3IKD8 1.28e-104 301 80 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudoalteromonas translucida (strain TAC 125)
Q8EE81 1.64e-104 301 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RJZ2 2.66e-104 300 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella sp. (strain W3-18-1)
A9L0K1 2.66e-104 300 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella baltica (strain OS195)
A6WN18 2.66e-104 300 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella baltica (strain OS185)
Q0HVF5 3.5e-104 300 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella sp. (strain MR-7)
Q0HII0 3.5e-104 300 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella sp. (strain MR-4)
Q87MX4 1.24e-103 299 79 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P71395 1.77e-103 298 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1S6M9 2.18e-103 298 73 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H536 2.55e-103 298 74 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1SSX5 2.66e-103 298 73 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A5UFC0 5.19e-103 297 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Haemophilus influenzae (strain PittGG)
A5UBJ2 5.19e-103 297 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Haemophilus influenzae (strain PittEE)
Q4QJQ8 5.19e-103 297 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Haemophilus influenzae (strain 86-028NP)
B8E548 9.39e-103 296 74 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella baltica (strain OS223)
A8FUY0 5.92e-102 295 73 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella sediminis (strain HAW-EB3)
Q12N30 1.83e-101 293 73 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0I487 2.31e-101 293 74 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Histophilus somni (strain 129Pt)
B0UUS0 2.72e-101 293 74 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Histophilus somni (strain 2336)
B8GMB4 1.79e-100 291 73 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A3QEN4 2.1e-98 286 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C1DEF3 1.11e-97 284 71 1 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8CM58 1.76e-97 283 75 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Shewanella piezotolerans (strain WP3 / JCM 13877)
Q2SKU4 1.76e-97 283 70 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Hahella chejuensis (strain KCTC 2396)
Q9CNP0 1.88e-97 283 77 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Pasteurella multocida (strain Pm70)
Q0VP41 3.29e-96 280 71 1 194 3 rnfA Ion-translocating oxidoreductase complex subunit A Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0AAG7 2.78e-95 278 67 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q482U3 5.2e-95 277 75 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9HYC0 1.16e-94 276 69 1 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QX8 1.16e-94 276 69 1 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UWJ4 1.16e-94 276 69 1 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudomonas aeruginosa (strain LESB58)
A1TZ65 2.04e-94 275 72 0 191 3 rnfA Ion-translocating oxidoreductase complex subunit A Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6V1T9 3.07e-94 275 68 1 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudomonas aeruginosa (strain PA7)
B8F7B7 1.79e-93 273 71 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Glaesserella parasuis serovar 5 (strain SH0165)
A4XS53 3.57e-93 272 69 1 194 3 rnfA Ion-translocating oxidoreductase complex subunit A Pseudomonas mendocina (strain ymp)
Q7VNT6 2.34e-91 268 76 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BS70 4.03e-90 265 74 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MYN7 4.03e-90 265 74 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1K2S9 1.27e-89 263 66 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Azoarcus sp. (strain BH72)
C4LEP7 3.8e-88 259 68 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3A7W6 7.97e-84 249 62 0 192 3 rnfA Ion-translocating oxidoreductase complex subunit A Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3IXC6 6.81e-83 246 62 0 190 3 rnfA Ion-translocating oxidoreductase complex subunit A Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PRP3 6.81e-83 246 62 0 190 3 rnfA Ion-translocating oxidoreductase complex subunit A Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8D718 2.55e-79 237 55 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57213 2.55e-79 237 55 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R4 2.55e-79 237 55 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
D5ARY9 2.89e-78 234 60 0 192 1 rnfA Ion-translocating oxidoreductase complex subunit A Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CZ13 2.89e-78 234 60 0 192 1 rnfA Ion-translocating oxidoreductase complex subunit A Rhodobacter capsulatus
Q5P539 1.34e-77 233 62 0 191 3 rnfA Ion-translocating oxidoreductase complex subunit A Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q89AX0 3.8e-74 224 53 0 190 3 rnfA Ion-translocating oxidoreductase complex subunit A Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
H6LC28 9.4e-72 218 54 0 186 1 rnfA Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit A Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
Q8KA21 1.95e-65 202 49 0 193 3 rnfA Ion-translocating oxidoreductase complex subunit A Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
D8GR70 3.72e-61 191 45 0 193 3 rnfA Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit A Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
Q8TSY0 2.25e-54 174 47 1 188 1 rnfA Ion-translocating oxidoreductase complex subunit A Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1QX82 8.25e-49 160 45 1 202 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5WBL5 2.45e-48 159 44 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Psychrobacter sp. (strain PRwf-1)
Q1Q7Z8 3.04e-48 159 45 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FPV3 3.04e-48 159 45 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9CLA7 8.18e-48 157 45 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pasteurella multocida (strain Pm70)
A8GAC3 9.63e-48 157 45 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Serratia proteamaculans (strain 568)
A4VMV0 2.95e-47 156 43 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Stutzerimonas stutzeri (strain A1501)
A1JNZ3 3.08e-47 156 44 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C1DR06 5.66e-47 155 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1U1Y9 6.04e-47 155 44 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q75R60 6.96e-47 155 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio anguillarum
Q7UWS1 8.71e-47 155 41 1 209 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1KSH4 1.31e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A9M2A7 1.31e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria meningitidis serogroup C (strain 053442)
A6T525 1.52e-46 154 44 2 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4RNG2 1.53e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria gonorrhoeae (strain NCCP11945)
Q5F6X6 1.53e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JVQ2 2.28e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
C3LQ63 2.38e-46 154 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio cholerae serotype O1 (strain M66-2)
Q9X4Q7 2.38e-46 154 42 1 196 1 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y5 2.38e-46 154 42 1 196 1 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q3IHN9 2.5e-46 154 43 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudoalteromonas translucida (strain TAC 125)
B8F5U9 2.65e-46 154 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Glaesserella parasuis serovar 5 (strain SH0165)
A4SQL6 2.71e-46 154 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Aeromonas salmonicida (strain A449)
Q604Z9 2.76e-46 154 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9K0M7 2.84e-46 154 43 1 195 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A5UFX2 3.79e-46 153 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Haemophilus influenzae (strain PittGG)
A5UAX5 3.79e-46 153 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Haemophilus influenzae (strain PittEE)
Q4QP20 3.79e-46 153 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Haemophilus influenzae (strain 86-028NP)
Q7N7F0 5.14e-46 153 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A0KHD0 5.92e-46 153 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1SSY7 8.27e-46 152 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0I5Y0 9.04e-46 152 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Histophilus somni (strain 129Pt)
B4EUT8 9.65e-46 152 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Proteus mirabilis (strain HI4320)
B0UWF8 1.56e-45 152 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Histophilus somni (strain 2336)
B0BS59 2.13e-45 151 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MYM6 2.13e-45 151 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6LTY5 2.74e-45 151 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Photobacterium profundum (strain SS9)
P71342 3.29e-45 151 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B3PFQ6 3.36e-45 151 41 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Cellvibrio japonicus (strain Ueda107)
Q2SIP7 4.34e-45 150 43 3 199 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Hahella chejuensis (strain KCTC 2396)
A4TPL3 4.71e-45 150 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Yersinia pestis (strain Pestoides F)
Q1CLD9 4.71e-45 150 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Yersinia pestis bv. Antiqua (strain Nepal516)
A5EUU4 5.88e-45 150 42 2 201 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Dichelobacter nodosus (strain VCS1703A)
C6BWF6 1.39e-44 149 40 2 194 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A6VLY0 1.62e-44 149 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65VU8 1.7e-44 149 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4LD55 2.51e-44 149 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q12QK2 4.3e-44 148 40 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B7VKD6 4.36e-44 148 43 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio atlanticus (strain LGP32)
Q9ZC45 5.34e-44 148 41 2 197 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Yersinia pestis
B5FBI4 6.24e-44 147 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Aliivibrio fischeri (strain MJ11)
Q5E6X2 6.24e-44 147 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q15YQ2 1.13e-43 147 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9HZL0 1.76e-43 147 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PF9 1.76e-43 147 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZU1 1.76e-43 147 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudomonas aeruginosa (strain LESB58)
A6V3A1 1.76e-43 147 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudomonas aeruginosa (strain PA7)
Q7MID1 1.97e-43 146 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio vulnificus (strain YJ016)
Q8DBJ2 1.97e-43 146 41 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio vulnificus (strain CMCP6)
Q87MB0 2.39e-43 146 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q56589 3.62e-43 145 42 1 196 1 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio alginolyticus
Q9RFV7 3.66e-43 145 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Vibrio campbellii (strain ATCC BAA-1116)
A4XSP7 4.33e-43 145 44 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Pseudomonas mendocina (strain ymp)
Q0VQR4 4.66e-43 145 45 2 201 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7VNU5 1.29e-42 144 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BBR2 2.77e-42 145 39 2 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7J7 2.77e-42 145 39 2 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q82SE7 3.87e-42 143 39 1 194 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
O84283 4.75e-42 144 39 2 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KM81 4.75e-42 144 39 2 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q9PKB3 2.18e-41 142 38 2 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia muridarum (strain MoPn / Nigg)
Q21JR8 5.22e-41 140 43 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5QYQ7 5.69e-41 140 42 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C5BII5 1.13e-40 139 39 1 200 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Teredinibacter turnerae (strain ATCC 39867 / T7901)
B6EIC7 5.89e-39 135 42 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Aliivibrio salmonicida (strain LFI1238)
Q487D7 9.72e-39 135 40 1 205 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q823P5 4.22e-38 135 36 1 196 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9Z8B3 5.68e-36 129 36 1 189 3 nqrE Na(+)-translocating NADH-quinone reductase subunit E Chlamydia pneumoniae
B2VEQ6 4.37e-21 90 36 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B3PB31 1.2e-20 89 37 3 154 3 rnfE Ion-translocating oxidoreductase complex subunit E Cellvibrio japonicus (strain Ueda107)
Q7VNT1 2.3e-20 87 36 3 150 3 rnfE Ion-translocating oxidoreductase complex subunit E Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8EE76 2.29e-18 82 36 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8H541 4.93e-18 81 35 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
C5BE26 1.12e-17 80 32 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Edwardsiella ictaluri (strain 93-146)
B7VLT3 1.46e-17 80 33 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio atlanticus (strain LGP32)
A3QEN9 1.57e-17 80 33 4 172 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7MM86 2.06e-17 80 32 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio vulnificus (strain YJ016)
Q8D885 2.06e-17 80 32 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio vulnificus (strain CMCP6)
A0KX84 3.69e-17 79 34 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella sp. (strain ANA-3)
Q0HVG0 3.81e-17 79 34 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella sp. (strain MR-7)
Q0HIH5 3.81e-17 79 34 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella sp. (strain MR-4)
Q9CNP5 4.73e-17 79 34 4 155 3 rnfE Ion-translocating oxidoreductase complex subunit E Pasteurella multocida (strain Pm70)
Q2NT00 5.09e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Sodalis glossinidius (strain morsitans)
B2K4J6 5.23e-17 79 31 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JKN8 5.4e-17 79 31 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A9L0J6 5.53e-17 79 33 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella baltica (strain OS195)
A6WN13 5.53e-17 79 33 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella baltica (strain OS185)
B8E553 5.53e-17 79 33 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella baltica (strain OS223)
A4TJ33 7.14e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pestis (strain Pestoides F)
Q1CIZ3 7.14e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZED4 7.14e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pestis
Q1C7K7 7.14e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHZ7 7.14e-17 79 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9R8U3 8.01e-17 78 33 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Yersinia pestis bv. Antiqua (strain Angola)
B8CM53 8.59e-17 78 34 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella piezotolerans (strain WP3 / JCM 13877)
A1RJZ7 8.73e-17 78 33 3 159 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella sp. (strain W3-18-1)
A4Y6I5 8.73e-17 78 33 3 159 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q15RL0 9.99e-17 78 34 3 144 3 rnfE Ion-translocating oxidoreductase complex subunit E Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q12N25 1.06e-16 78 31 4 172 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8GMB9 1.51e-16 77 33 2 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q57020 1.52e-16 77 32 3 150 3 rnfE Ion-translocating oxidoreductase complex subunit E Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QJQ3 1.54e-16 77 32 3 150 3 rnfE Ion-translocating oxidoreductase complex subunit E Haemophilus influenzae (strain 86-028NP)
A5UFC5 1.65e-16 77 32 3 150 3 rnfE Ion-translocating oxidoreductase complex subunit E Haemophilus influenzae (strain PittGG)
Q081P2 2.42e-16 77 33 3 159 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella frigidimarina (strain NCIMB 400)
A1TZ60 2.82e-16 77 34 2 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8KA17 3.99e-16 76 35 3 145 3 rnfE Ion-translocating oxidoreductase complex subunit E Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B6EGH2 5.39e-16 76 35 3 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Aliivibrio salmonicida (strain LFI1238)
A1S6N4 5.51e-16 76 33 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A5F2S7 7.43e-16 75 31 3 156 1 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LTR0 1.05e-15 75 31 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio cholerae serotype O1 (strain M66-2)
Q9KT91 1.05e-15 75 31 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87MW9 1.41e-15 75 30 3 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UBI7 1.43e-15 75 31 3 150 3 rnfE Ion-translocating oxidoreductase complex subunit E Haemophilus influenzae (strain PittEE)
B8D723 4.54e-15 73 36 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57218 4.54e-15 73 36 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R9 4.69e-15 73 36 4 147 3 rnfE Ion-translocating oxidoreductase complex subunit E Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B7UVW8 1.48e-14 72 37 1 106 3 rnfE Ion-translocating oxidoreductase complex subunit E Pseudomonas aeruginosa (strain LESB58)
Q9F5Y1 1.5e-14 72 39 4 143 1 rnfE Ion-translocating oxidoreductase complex subunit E Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9HYB5 1.64e-14 72 37 1 106 3 rnfE Ion-translocating oxidoreductase complex subunit E Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8TSY1 2.03e-14 71 35 5 150 1 rnfE Ion-translocating oxidoreductase complex subunit E Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B5FCN0 2.33e-14 72 33 3 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Aliivibrio fischeri (strain MJ11)
Q5E6C1 2.61e-14 71 33 3 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q02QY3 5.21e-14 71 36 1 106 3 rnfE Ion-translocating oxidoreductase complex subunit E Pseudomonas aeruginosa (strain UCBPP-PA14)
P97055 1.04e-13 70 33 4 143 1 rnfE Ion-translocating oxidoreductase complex subunit E Rhodobacter capsulatus
Q89AW5 3.61e-13 68 33 2 156 3 rnfE Ion-translocating oxidoreductase complex subunit E Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A7MML2 9.7e-13 67 32 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Cronobacter sakazakii (strain ATCC BAA-894)
Q9EVN2 3.86e-12 66 37 5 143 3 rnfE Ion-translocating oxidoreductase complex subunit E Stutzerimonas stutzeri
B8F7B0 8.28e-12 65 31 4 151 3 rnfE Ion-translocating oxidoreductase complex subunit E Glaesserella parasuis serovar 5 (strain SH0165)
Q2W403 1.37e-11 64 29 2 142 3 rnfE Ion-translocating oxidoreductase complex subunit E Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q9CLA8 1.54e-11 63 32 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pasteurella multocida (strain Pm70)
B7LQN8 3.18e-11 63 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LEQ4 3.67e-11 63 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain SMS-3-5 / SECEC)
B5XWP6 4.27e-11 63 32 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Klebsiella pneumoniae (strain 342)
Q0THJ5 4.72e-11 63 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5FIF0 6.76e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella dublin (strain CT_02021853)
B4T591 6.83e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella newport (strain SL254)
P65540 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65541 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella typhi
B4TV14 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella schwarzengrund (strain CVM19633)
C0Q511 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella paratyphi C (strain RKS4594)
A9N028 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4THD1 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella heidelberg (strain SL476)
B5RAK5 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV05 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella enteritidis PT4 (strain P125109)
Q57PI3 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella choleraesuis (strain SC-B67)
B5F6J3 7.11e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella agona (strain SL483)
A9MEG7 7.26e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BKB5 7.4e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella paratyphi A (strain AKU_12601)
Q5PIC6 7.4e-11 62 31 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1RBG4 8.12e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain UTI89 / UPEC)
A1ABH7 8.12e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O1:K1 / APEC
B7MVB0 8.12e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O81 (strain ED1a)
B7M9Y6 8.12e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URX3 8.12e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FH92 8.45e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3Z1Y7 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Shigella sonnei (strain Ss046)
Q320Y9 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Shigella boydii serotype 4 (strain Sb227)
B2U2D1 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6IB70 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain SE11)
B7M0I9 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O8 (strain IAI1)
B5Z466 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58344 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O157:H7
B7L5I5 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain 55989 / EAEC)
A7ZM92 8.62e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NU01 9.25e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32FE1 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Shigella dysenteriae serotype 1 (strain Sd197)
B7NB86 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P77179 9.34e-11 62 32 4 161 1 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain K12)
B1IQC2 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0H5 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli O9:H4 (strain HS)
B1XFU4 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain K12 / DH10B)
C4ZY95 9.34e-11 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Escherichia coli (strain K12 / MC4100 / BW2952)
Q0T4E5 1.12e-10 62 32 4 161 3 rsxE Ion-translocating oxidoreductase complex subunit E Shigella flexneri serotype 5b (strain 8401)
H6LC29 1.21e-10 61 31 5 151 1 rnfE Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit E Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
A8AH13 4.15e-10 60 31 4 161 3 rnfE Ion-translocating oxidoreductase complex subunit E Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q15YQ3 2.97e-09 57 29 2 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1JII7 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66E03 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPL4 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pestis (strain Pestoides F)
Q1CLE0 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2Y3 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBZ3 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pestis
B2K647 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4D3 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLJ5 4.99e-09 57 30 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P43958 5.56e-09 57 29 3 155 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFX1 5.56e-09 57 29 3 155 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Haemophilus influenzae (strain PittGG)
A5UAX4 5.56e-09 57 29 3 155 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Haemophilus influenzae (strain PittEE)
Q4QP21 5.56e-09 57 29 3 155 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Haemophilus influenzae (strain 86-028NP)
Q7N7F1 1.13e-08 56 29 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EUT7 2.8e-08 55 29 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Proteus mirabilis (strain HI4320)
Q9JVQ1 3.62e-08 54 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6X7 3.62e-08 54 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KSH5 4.29e-08 54 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K0M6 4.29e-08 54 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M2A8 4.29e-08 54 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Neisseria meningitidis serogroup C (strain 053442)
A6V1T4 4.59e-08 54 36 1 106 3 rnfE Ion-translocating oxidoreductase complex subunit E Pseudomonas aeruginosa (strain PA7)
A8GAC2 6.64e-08 53 29 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Serratia proteamaculans (strain 568)
Q9RFV8 8.02e-08 53 31 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio campbellii (strain ATCC BAA-1116)
Q57095 8.86e-08 53 31 3 145 1 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio alginolyticus
Q87MA9 9.49e-08 53 31 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4LD54 1.55e-07 53 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7VNU6 1.97e-07 52 28 3 142 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IHN8 2.5e-07 52 31 4 148 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudoalteromonas translucida (strain TAC 125)
B5FBI3 6.42e-07 51 30 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Aliivibrio fischeri (strain MJ11)
Q5E6X3 6.42e-07 51 30 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1JNZ5 7.45e-07 50 30 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q086L0 7.89e-07 50 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella frigidimarina (strain NCIMB 400)
A8H779 1.01e-06 50 26 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1SSY6 1.12e-06 50 25 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9Z8B4 1.27e-06 50 29 4 154 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia pneumoniae
A1RN03 1.34e-06 50 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella sp. (strain W3-18-1)
A4Y3Y9 1.34e-06 50 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8CKC7 1.65e-06 50 26 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8DBJ3 1.69e-06 50 29 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio vulnificus (strain CMCP6)
A8FYV9 1.92e-06 49 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella sediminis (strain HAW-EB3)
B0TR00 2.34e-06 49 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella halifaxensis (strain HAW-EB4)
Q6LTY6 3.17e-06 49 30 3 146 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Photobacterium profundum (strain SS9)
B0BBR1 3.51e-06 49 27 3 154 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7J6 3.51e-06 49 27 3 154 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84282 3.65e-06 48 27 3 154 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KM82 3.65e-06 48 27 3 154 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
A3QGZ6 3.74e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5L6C2 4.02e-06 48 27 4 157 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia abortus (strain DSM 27085 / S26/3)
Q75R61 4.5e-06 48 29 3 148 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio anguillarum
A0KHC9 4.72e-06 48 28 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SQL7 4.81e-06 48 28 3 150 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Aeromonas salmonicida (strain A449)
Q7MID0 4.96e-06 48 28 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio vulnificus (strain YJ016)
Q8EHV6 5.57e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L0U1 5.68e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella baltica (strain OS195)
A6WRX3 5.68e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella baltica (strain OS185)
A3D139 5.68e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EC46 5.68e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella baltica (strain OS223)
Q0HY29 6.02e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella sp. (strain MR-7)
Q0HLP8 6.02e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella sp. (strain MR-4)
A0KTQ7 6.02e-06 48 26 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella sp. (strain ANA-3)
B7VKD5 6.14e-06 48 29 3 148 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio atlanticus (strain LGP32)
Q253X2 6.16e-06 48 27 6 196 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia felis (strain Fe/C-56)
Q12QK3 6.2e-06 48 27 3 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
D8GR69 7.13e-06 48 26 3 160 3 rnfE Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit E Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
B1KD43 8.3e-06 48 26 2 147 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Shewanella woodyi (strain ATCC 51908 / MS32)
C3LQ64 8.54e-06 48 29 3 148 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio cholerae serotype O1 (strain M66-2)
Q9X4Q6 8.54e-06 48 29 3 148 1 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y6 8.54e-06 48 29 3 148 1 nqrD Na(+)-translocating NADH-quinone reductase subunit D Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q823P4 1.66e-05 47 26 4 157 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A6V3A0 0.000182 44 27 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudomonas aeruginosa (strain PA7)
Q9HZK9 0.000321 43 26 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PG0 0.000321 43 26 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZU0 0.000321 43 26 3 145 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Pseudomonas aeruginosa (strain LESB58)
Q9PKB4 0.000362 43 27 3 149 3 nqrD Na(+)-translocating NADH-quinone reductase subunit D Chlamydia muridarum (strain MoPn / Nigg)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06290
Feature type CDS
Gene rsxA
Product electron transport complex subunit RsxA
Location 1378996 - 1379577 (strand: 1)
Length 582 (nucleotides) / 193 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_925
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02508 Rnf-Nqr subunit, membrane protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4657 Energy production and conversion (C) C Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03617 H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit A - -

Protein Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGFATTFVMTIASISSWLMDTFILVPLDLLYLRTLSFILVIAVVVQFTEMVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNINQSHTFMQSAVYGFGAAVGFSLVMVLFAAIRERLAVANIPAPFKGSSIGLITAGLMSLAFMGFSGLVKL

Flanking regions ( +/- flanking 50bp)

CTTTATTTTATGAGGCTTTTTCTCCATTTTTTAACAATTTTGGCATAGCAATGACTGATTACTTGCTTTTATTCGTTGGTACCGTCTTGGTGAATAACTTTGTACTCGTCAAATTCCTCGGTTTATGCCCATTTATGGGTGTATCAAAAAAATTAGAAACCGCGATAGGAATGGGGTTTGCGACAACGTTTGTCATGACGATTGCCTCTATTAGCTCTTGGCTAATGGATACCTTTATTTTAGTTCCCTTAGACTTACTCTATTTACGTACACTCAGCTTTATTTTAGTGATTGCTGTTGTGGTGCAATTTACAGAAATGGTCGTAAGAAAGACGAGTCCAACGTTATATCGTCTATTGGGGATTTTCTTACCTTTAATTACCACCAACTGTGCCGTATTAGGGGTCGCGTTACTGAATATCAATCAATCACATACCTTTATGCAATCAGCAGTATATGGTTTTGGTGCTGCGGTAGGATTCTCCTTAGTTATGGTGTTATTTGCAGCCATTAGAGAAAGACTGGCTGTCGCCAATATTCCTGCTCCTTTCAAAGGCTCTTCTATTGGCTTAATTACTGCGGGTTTAATGTCTCTTGCCTTTATGGGTTTTAGTGGTTTGGTGAAACTGTAATGAATTCTTTATGGATAGCAATTGGTGTACTGGGTGTACTAGGGCTTCTA