Homologs in group_924

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05020 FBDBKF_05020 51.7 Morganella morganii S1 mviM putative dehydrogenase
EHELCC_12570 EHELCC_12570 51.7 Morganella morganii S2 mviM putative dehydrogenase
NLDBIP_12910 NLDBIP_12910 51.7 Morganella morganii S4 mviM putative dehydrogenase
LHKJJB_12770 LHKJJB_12770 51.7 Morganella morganii S3 mviM putative dehydrogenase
HKOGLL_11385 HKOGLL_11385 51.7 Morganella morganii S5 mviM putative dehydrogenase
F4V73_RS05460 F4V73_RS05460 51.4 Morganella psychrotolerans - oxidoreductase

Distribution of the homologs in the orthogroup group_924

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_924

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77376 1.07e-138 400 57 3 348 1 ydgJ Uncharacterized oxidoreductase YdgJ Escherichia coli (strain K12)
O32223 2.22e-98 298 42 3 345 1 iolW scyllo-inositol 2-dehydrogenase (NADP(+)) IolW Bacillus subtilis (strain 168)
O13991 1.17e-62 207 35 7 365 2 SPAC26H5.09c Uncharacterized oxidoreductase C26H5.09c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O42896 3.03e-61 203 33 10 369 3 SPBC115.03 Uncharacterized oxidoreductase C115.03 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P46853 3.95e-58 194 33 6 349 1 yhhX Uncharacterized oxidoreductase YhhX Escherichia coli (strain K12)
T2KNC8 1.28e-20 94 32 4 201 2 BN863_22240 Oxidoreductase P35 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q44258 5.93e-16 81 28 3 183 4 cbaC 1-carboxy-3-chloro-3,4-dihydroxycyclo hexa-1,5-diene dehydrogenase Comamonas testosteroni
Q9WYP5 3.92e-15 78 25 4 198 1 iolG Myo-inositol 2-dehydrogenase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P77503 9.79e-15 77 27 3 198 1 ycjS D-glucoside 3-dehydrogenase Escherichia coli (strain K12)
Q2I8V6 7.1e-14 75 24 4 256 1 afr 1,5-anhydro-D-fructose reductase Ensifer adhaerens
P49305 2.25e-13 73 27 5 193 3 None Uncharacterized oxidoreductase ORF334 Rhizobium meliloti
P74041 1.16e-12 71 27 5 208 3 sll0816 Uncharacterized oxidoreductase sll0816 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O07564 1.65e-12 71 27 4 179 1 ntdC Glucose-6-phosphate 3-dehydrogenase Bacillus subtilis (strain 168)
O05389 2.42e-12 70 28 4 193 3 yrbE Uncharacterized oxidoreductase YrbE Bacillus subtilis (strain 168)
Q92KZ3 3.33e-12 70 26 5 260 1 afr 1,5-anhydro-D-fructose reductase Rhizobium meliloti (strain 1021)
Q0SH07 3.45e-12 70 27 3 162 3 iolG Inositol 2-dehydrogenase Rhodococcus jostii (strain RHA1)
F0M433 4.78e-12 70 25 7 288 1 lgdh Levoglucosan dehydrogenase Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3)
P40332 5.03e-12 69 29 2 136 1 iolX scyllo-inositol 2-dehydrogenase (NAD(+)) Bacillus subtilis (strain 168)
Q9ALN5 6.84e-12 69 29 6 186 1 spnN dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase Saccharopolyspora spinosa
Q5WKY6 1.62e-11 68 28 3 146 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Shouchella clausii (strain KSM-K16)
Q8XZZ9 1.99e-11 67 26 3 179 3 iolG Inositol 2-dehydrogenase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6WFC5 2.62e-11 67 29 2 142 3 iolG Inositol 2-dehydrogenase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A6THJ2 3.6e-11 67 27 3 145 3 iolG Inositol 2-dehydrogenase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
D4GP30 4.1e-11 66 25 10 322 1 HVO_B0029 D-xylose 1-dehydrogenase (NADP(+)) 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9RR32 4.72e-11 66 28 2 191 1 oleW dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase Streptomyces antibioticus
A7ZAH5 5.52e-11 66 24 3 146 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q07982 6.64e-11 66 25 5 201 1 gfo Glucose--fructose oxidoreductase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B5Y2S5 9.14e-11 65 26 3 145 3 iolG Inositol 2-dehydrogenase Klebsiella pneumoniae (strain 342)
A1B2N1 3.26e-10 64 25 2 153 3 iolG Inositol 2-dehydrogenase Paracoccus denitrificans (strain Pd 1222)
Q05184 4.64e-10 63 26 4 193 2 pht4 Putative 4,5-dihydroxyphthalate dehydrogenase Pseudomonas putida
P26935 8.49e-10 62 26 3 146 1 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Bacillus subtilis (strain 168)
A4FID1 8.52e-10 62 24 2 145 3 iolG2 Inositol 2-dehydrogenase 2 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
P39353 1.23e-09 62 24 10 290 1 nanY 2,7-anhydro-N-acetylneuraminate hydratase Escherichia coli (strain K12)
Q7CV90 2.94e-09 61 24 4 154 3 iolG Inositol 2-dehydrogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6DKE0 3.33e-09 60 26 7 211 2 dhdh Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Xenopus laevis
A0R191 3.41e-09 61 26 2 145 3 iolG Inositol 2-dehydrogenase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O68965 5.22e-09 60 29 4 163 1 idhA Inositol 2-dehydrogenase Rhizobium meliloti (strain 1021)
C5BYN4 5.97e-09 60 22 5 206 3 iolG Inositol 2-dehydrogenase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q04869 6.16e-09 60 24 9 261 1 YMR315W Uncharacterized protein YMR315W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8ZK57 7.12e-09 60 23 2 145 1 iolG Inositol 2-dehydrogenase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N564 7.12e-09 60 23 2 145 3 iolG Inositol 2-dehydrogenase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5F3F4 7.12e-09 60 23 2 145 3 iolG Inositol 2-dehydrogenase Salmonella agona (strain SL483)
A4FDY3 8.2e-09 60 26 3 121 3 iolG1 Inositol 2-dehydrogenase 1 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A4Y8C8 9.14e-09 60 25 3 161 3 Sputcn32_2490 Glycosyl hydrolase family 109 protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KV43 9.73e-09 60 27 4 161 3 Shewana3_1428 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain ANA-3)
A1RI61 1.04e-08 60 26 5 161 3 Sputw3181_1518 Glycosyl hydrolase family 109 protein Shewanella sp. (strain W3-18-1)
Q0HWR6 1.24e-08 59 27 4 161 3 Shewmr7_1440 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain MR-7)
Q0HKG4 1.25e-08 59 27 4 161 3 Shewmr4_1375 Glycosyl hydrolase family 109 protein 1 Shewanella sp. (strain MR-4)
P37168 1.57e-08 58 29 2 128 1 yceM Putative oxidoreductase YceM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q53TZ2 1.61e-08 58 23 11 326 1 araA L-arabinose 1-dehydrogenase (NAD(P)(+)) Azospirillum brasilense
A9H5B7 2.02e-08 58 23 3 146 3 iolG Inositol 2-dehydrogenase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A8H2K3 2.19e-08 58 24 2 160 3 Spea_1465 Glycosyl hydrolase family 109 protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8ECL7 2.83e-08 58 25 3 161 3 nagA Alpha-N-acetylgalactosaminidase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q65D06 3.68e-08 57 24 3 145 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8GKW1 4.49e-08 57 24 3 145 3 iolG Inositol 2-dehydrogenase Serratia proteamaculans (strain 568)
Q5LGW9 4.52e-08 58 25 2 136 3 BF0874 Alpha-N-acetylgalactosaminidase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64XS1 4.73e-08 57 25 2 136 3 BF0955 Glycosyl hydrolase family 109 protein 2 Bacteroides fragilis (strain YCH46)
B9JK80 4.89e-08 57 25 9 258 1 apsD D-apiose dehydrogenase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q6DF30 4.99e-08 57 25 7 218 2 dhdh Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Xenopus tropicalis
A3D6B7 5.54e-08 57 26 4 161 3 Sbal_2793 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KUT1 5.69e-08 57 26 4 161 3 Sbal195_2933 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS195)
A6WQ58 5.69e-08 57 26 4 161 3 Shew185_2813 Glycosyl hydrolase family 109 protein Shewanella baltica (strain OS185)
P0C863 6.98e-08 57 25 3 172 3 BF0931 Glycosyl hydrolase family 109 protein 1 Bacteroides fragilis (strain YCH46)
Q5LGZ0 6.98e-08 57 25 3 172 1 BF0853 Glycosyl hydrolase family 109 protein 1 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q54728 9.3e-08 57 23 6 194 3 SP_1686 Uncharacterized oxidoreductase SP_1686 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q7BUE1 1.07e-07 56 30 9 200 1 rifL Putative UDP-kanosamine synthase oxidoreductase subunit Amycolatopsis mediterranei (strain S699)
A1JSK7 1.34e-07 56 23 4 151 3 iolG Inositol 2-dehydrogenase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6M0B9 1.36e-07 55 24 9 250 1 MMP0352 UDP-N-acetylglucosamine 3-dehydrogenase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A9ABZ7 1.43e-07 56 23 4 195 3 iolG Inositol 2-dehydrogenase Burkholderia multivorans (strain ATCC 17616 / 249)
A4FK61 1.45e-07 56 26 3 150 3 iolG4 Inositol 2-dehydrogenase 4 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q9ZA33 1.58e-07 55 25 5 198 1 gra-orf26 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase Streptomyces violaceoruber
B3TMR8 1.59e-07 55 26 4 189 1 KijD10 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase Actinomadura kijaniata
A5YBJ7 1.71e-07 55 25 3 144 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Lacticaseibacillus casei
Q88S38 3.23e-07 55 22 3 157 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q89ZX8 3.29e-07 55 25 3 172 3 BT_4243 Glycosyl hydrolase family 109 protein 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q89ZW9 3.33e-07 55 27 4 160 3 BT_4252 Glycosyl hydrolase family 109 protein 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7MWF4 5.48e-07 54 25 4 180 3 PG_0664 Glycosyl hydrolase family 109 protein Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A4FN60 5.81e-07 54 24 2 155 3 SACE_6314 Glycosyl hydrolase family 109 protein Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B7JA34 6.05e-07 53 27 2 122 1 gnnA UDP-N-acetylglucosamine 3-dehydrogenase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A0A024SMV2 7.28e-07 54 31 0 93 1 xyd1 D-xylose 1-dehydrogenase (NADP(+)) Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)
P94437 7.72e-07 53 23 3 134 3 yfiI Uncharacterized oxidoreductase YfiI Bacillus subtilis (strain 168)
B1G894 8.46e-07 53 24 6 226 1 apsD D-apiose dehydrogenase Paraburkholderia graminis (strain ATCC 700544 / DSM 17151 / LMG 18924 / NCIMB 13744 / C4D1M)
C3K9I8 8.69e-07 53 21 4 179 3 iolG Inositol 2-dehydrogenase Pseudomonas fluorescens (strain SBW25)
Q8GAK6 8.97e-07 53 23 11 316 1 xdh D-xylose dehydrogenase Paenarthrobacter nicotinovorans
A1S4U5 9.35e-07 53 26 4 160 3 Sama_1194 Glycosyl hydrolase family 109 protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4FIQ1 1.05e-06 53 22 2 143 3 iolG3 Inositol 2-dehydrogenase 3 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A0JT53 1.17e-06 53 24 2 149 3 iolG Inositol 2-dehydrogenase Arthrobacter sp. (strain FB24)
Q9SZ83 1.29e-06 53 22 8 209 1 At4g09670 Uncharacterized oxidoreductase At4g09670 Arabidopsis thaliana
Q4KDI5 1.43e-06 53 21 3 179 3 iolG Inositol 2-dehydrogenase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZRC2 1.8e-06 52 21 4 178 3 iolG Inositol 2-dehydrogenase Pseudomonas syringae pv. syringae (strain B728a)
P11886 1.8e-06 52 28 2 101 1 gal Galactose 1-dehydrogenase Pseudomonas fluorescens
A6KY05 1.83e-06 53 29 0 96 3 BVU_0611 Glycosyl hydrolase family 109 protein 2 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A9BZG3 2.15e-06 52 23 2 145 3 iolG Inositol 2-dehydrogenase Delftia acidovorans (strain DSM 14801 / SPH-1)
P75931 2.21e-06 52 27 2 124 1 yceM Putative oxidoreductase YceM Escherichia coli (strain K12)
A1TC97 2.37e-06 52 23 2 145 3 iolG2 Inositol 2-dehydrogenase 2 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A7B558 2.63e-06 52 22 6 199 1 RUMGNA_02695 2,7-anhydro-N-acetylneuraminate hydratase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
P49307 3.63e-06 51 28 3 146 3 mocA Rhizopine catabolism protein MocA Rhizobium meliloti
A4JDP6 3.89e-06 51 21 4 196 3 iolG Inositol 2-dehydrogenase Burkholderia vietnamiensis (strain G4 / LMG 22486)
C1DLA8 4.93e-06 51 24 3 145 3 iolG Inositol 2-dehydrogenase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5G0Y2 5.36e-06 51 24 3 153 3 iolG Inositol 2-dehydrogenase Acidiphilium cryptum (strain JF-5)
Q48GY3 5.41e-06 51 21 4 178 3 iolG Inositol 2-dehydrogenase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87ZD5 6.36e-06 51 21 4 178 3 iolG Inositol 2-dehydrogenase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q82NQ8 6.5e-06 51 22 2 148 3 iolG Inositol 2-dehydrogenase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9KAH1 6.66e-06 50 23 3 145 3 iolG Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3B7J2 7.29e-06 50 24 8 193 1 GFOD2 Glucose-fructose oxidoreductase domain-containing protein 2 Homo sapiens
B1KNF7 7.29e-06 51 23 3 160 3 Swoo_1749 Glycosyl hydrolase family 109 protein Shewanella woodyi (strain ATCC 51908 / MS32)
A6KX96 8.6e-06 50 24 6 223 3 BVU_0340 Glycosyl hydrolase family 109 protein 1 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q1AV95 8.69e-06 50 27 2 118 3 iolG Inositol 2-dehydrogenase Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B2VJP4 8.87e-06 50 20 3 178 3 iolG Inositol 2-dehydrogenase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1T235 1.05e-05 50 23 2 144 3 iolG1 Inositol 2-dehydrogenase 1 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A6KYY1 1.36e-05 50 27 0 96 3 BVU_0950 Glycosyl hydrolase family 109 protein 3 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A1R665 1.41e-05 50 26 3 150 3 iolG1 Inositol 2-dehydrogenase 1 Paenarthrobacter aurescens (strain TC1)
B1W5J7 1.56e-05 50 27 3 131 3 SGR_6325 Glycosyl hydrolase family 109 protein Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
D4GP29 2.61e-05 49 25 4 183 1 xacA D-xylose 1-dehydrogenase [NADP(+)] 1 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q50EA3 2.84e-05 49 23 2 153 3 None Glycosyl hydrolase family 109 protein Streptomyces filamentosus
O05265 2.91e-05 48 23 5 202 1 iolU scyllo-inositol 2-dehydrogenase (NADP(+)) IolU Bacillus subtilis (strain 168)
B8HDD2 2.91e-05 48 21 2 149 3 iolG Inositol 2-dehydrogenase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
C0ZWI9 3.97e-05 48 26 2 140 3 iolG Inositol 2-dehydrogenase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q0HH61 5.16e-05 48 25 2 160 3 Shewmr4_2535 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain MR-4)
Q0HTG8 5.2e-05 48 25 2 160 3 Shewmr7_2602 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain MR-7)
A0KYQ9 5.2e-05 48 25 2 160 3 Shewana3_2701 Glycosyl hydrolase family 109 protein 2 Shewanella sp. (strain ANA-3)
A6KWM1 7.35e-05 48 23 3 152 3 BVU_0105 Glycosyl hydrolase family 109 protein 4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q642M9 7.53e-05 47 22 4 196 2 dhdh Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Danio rerio
Q6P4M5 7.95e-05 47 24 8 185 2 gfod1 Glucose-fructose oxidoreductase domain-containing protein 1 Xenopus tropicalis
Q01S58 0.000109 47 28 0 90 3 Acid_6590 Glycosyl hydrolase family 109 protein Solibacter usitatus (strain Ellin6076)
Q148L6 0.000143 47 28 7 168 2 DHDH Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase Bos taurus
O34371 0.000147 47 20 2 129 2 yteT Putative oxidoreductase YteT Bacillus subtilis (strain 168)
Q9RK81 0.000157 47 25 3 132 3 SCO0529 Glycosyl hydrolase family 109 protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q50HM6 0.000162 47 26 0 89 3 None Glycosyl hydrolase family 109 protein Streptomyces niveus
A6L1Z2 0.000198 46 23 9 241 3 BVU_2041 Glycosyl hydrolase family 109 protein 5 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C3MH72 0.000285 45 26 2 142 3 iolG Inositol 2-dehydrogenase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55480 0.000362 45 38 0 57 3 NGR_a03370 Uncharacterized oxidoreductase y4hM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1K045 0.00038 45 21 4 196 3 iolG Inositol 2-dehydrogenase Burkholderia orbicola (strain MC0-3)
P42599 0.000447 45 22 6 225 3 ygjR Uncharacterized oxidoreductase YgjR Escherichia coli (strain K12)
A0LVX1 0.001 44 24 3 179 3 iolG Inositol 2-dehydrogenase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q9X7U5 0.001 44 22 2 150 3 iolG Inositol 2-dehydrogenase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06280
Feature type CDS
Gene -
Product oxidoreductase
Location 1377259 - 1378302 (strand: -1)
Length 1044 (nucleotides) / 347 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_924
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01408 Oxidoreductase family, NAD-binding Rossmann fold
PF02894 Oxidoreductase family, C-terminal alpha/beta domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0673 General function prediction only (R) R Predicted dehydrogenase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16044 scyllo-inositol 2-dehydrogenase (NADP+) [EC:1.1.1.371] Inositol phosphate metabolism
Metabolic pathways
Microbial metabolism in diverse environments		 -

Protein Sequence

MTKNLNVGIIGYGYASKTFHAPLICTTEGLTLSAISSSDESKVIADFPNITVYANPQRLIDDPDIDLIVIPTPNNTHYTYASQALKNGKHVVVDKPFTLTLDEAEKLAQQAKEAKRLLSVFHNRRWDAGFLTVQKLLADKTLGEVSAYEAHFDRFRPAVRQRWREDAGLGGGLWYDLAPHLLDQAVCLFGQPYAITADIAQLRPNAKNADYFHTLLDYGHLKVILHASMLVASPTPIFAIHGTKGSYVKYGLDTQEDALKAGYLPTEMYNWGADPQEGELTLSTESGEVVTTKLPTLSGNYPAYYQQIYRAIAFGEESPVTVSQAINVMRLIEAGSLSNQSKTTIKL

Flanking regions ( +/- flanking 50bp)

GAAAGTCATTTTTCATTTATAGAATAAAAAGATAAAAGCGGGATAGGGTTATGACAAAAAATTTAAATGTGGGGATTATAGGCTATGGTTATGCAAGTAAAACCTTTCATGCTCCCCTGATCTGTACCACTGAGGGGTTAACACTATCAGCCATTTCAAGCTCTGATGAAAGTAAAGTTATCGCTGATTTTCCTAATATTACGGTGTATGCTAACCCACAACGACTGATTGATGATCCAGACATCGATTTAATTGTTATTCCAACACCTAATAACACTCACTATACCTACGCCTCACAAGCCTTAAAAAACGGTAAACATGTTGTTGTCGATAAACCTTTTACTTTGACACTCGATGAAGCAGAAAAATTGGCACAACAAGCGAAAGAAGCTAAGAGATTACTCTCGGTTTTTCATAATCGTCGTTGGGATGCCGGTTTTCTTACCGTTCAAAAATTACTCGCCGATAAAACATTAGGTGAAGTCAGTGCCTATGAAGCGCATTTCGATCGTTTTAGACCCGCTGTGCGCCAACGTTGGCGTGAAGATGCCGGACTTGGTGGAGGACTTTGGTACGATCTGGCCCCTCATTTACTAGACCAAGCGGTATGTCTTTTTGGTCAACCTTATGCAATCACTGCTGATATTGCTCAGTTGCGCCCTAATGCTAAAAATGCTGACTACTTTCATACACTATTAGACTATGGTCATCTGAAAGTTATTTTACATGCCTCTATGTTGGTTGCCTCACCTACGCCTATTTTTGCTATTCATGGGACCAAAGGCAGTTATGTAAAATATGGTTTAGATACCCAAGAAGATGCATTAAAAGCGGGTTATCTCCCGACGGAAATGTATAACTGGGGGGCTGATCCTCAAGAGGGTGAATTAACATTATCGACAGAGAGTGGTGAAGTAGTAACAACAAAGTTACCGACTCTATCAGGTAATTATCCCGCTTATTATCAGCAAATTTATCGTGCGATTGCATTTGGTGAAGAGAGTCCTGTTACTGTGTCACAGGCCATTAATGTTATGCGTTTAATTGAAGCCGGTAGCCTTTCAAATCAATCAAAAACCACAATTAAGCTGTAAACATTAGGGAGTGACGAAAACCATGTCTTGGTGGCAAAAGCTAAAAATTG