Homologs in group_767

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02960 FBDBKF_02960 55.8 Morganella morganii S1 - DUF1161 domain-containing protein
EHELCC_03430 EHELCC_03430 55.8 Morganella morganii S2 - DUF1161 domain-containing protein
NLDBIP_00030 NLDBIP_00030 55.8 Morganella morganii S4 - DUF1161 domain-containing protein
LHKJJB_02005 LHKJJB_02005 55.8 Morganella morganii S3 - DUF1161 domain-containing protein
HKOGLL_02045 HKOGLL_02045 55.8 Morganella morganii S5 - DUF1161 domain-containing protein
F4V73_RS05400 F4V73_RS05400 53.2 Morganella psychrotolerans - DUF1161 domain-containing protein

Distribution of the homologs in the orthogroup group_767

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_767

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76172 1.04e-16 71 53 0 56 1 ynfD Uncharacterized protein YnfD Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06225
Feature type CDS
Gene -
Product DUF1161 domain-containing protein
Location 1363465 - 1363701 (strand: 1)
Length 237 (nucleotides) / 78 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_767
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06649 Protein of unknown function (DUF1161)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2834 Cell wall/membrane/envelope biogenesis (M) M Outer membrane lipoprotein-sorting protein

Protein Sequence

MKKYLFALLATLFAFAPLAANAGCDEVVQDIQQKIENNGVPAANFTLTVVENDQVAQTEGKVVGTCENDSKKIIYTRH

Flanking regions ( +/- flanking 50bp)

ATATAAATAAAACAATGATGTTTTAAAAATCAAGCAAGGAGAGAAATGTTATGAAAAAATATCTATTTGCATTACTGGCTACATTGTTCGCATTTGCACCTTTAGCCGCAAATGCTGGATGTGATGAAGTCGTTCAAGATATTCAACAAAAAATTGAAAATAATGGTGTTCCTGCGGCTAACTTTACCCTAACAGTGGTTGAAAATGATCAAGTTGCACAGACTGAAGGTAAAGTTGTAGGTACTTGTGAAAATGATTCTAAAAAAATCATTTATACTCGCCATTAATCATTGATTTAATAGAATTAATAGCTAAAAAGGGTACTTTGTGTGCCCTT