Homologs in group_767

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02960 FBDBKF_02960 90.9 Morganella morganii S1 - DUF1161 domain-containing protein
EHELCC_03430 EHELCC_03430 90.9 Morganella morganii S2 - DUF1161 domain-containing protein
NLDBIP_00030 NLDBIP_00030 90.9 Morganella morganii S4 - DUF1161 domain-containing protein
LHKJJB_02005 LHKJJB_02005 90.9 Morganella morganii S3 - DUF1161 domain-containing protein
HKOGLL_02045 HKOGLL_02045 90.9 Morganella morganii S5 - DUF1161 domain-containing protein
PMI_RS06225 PMI_RS06225 53.2 Proteus mirabilis HI4320 - DUF1161 domain-containing protein

Distribution of the homologs in the orthogroup group_767

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_767

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76172 3.43e-15 67 50 0 56 1 ynfD Uncharacterized protein YnfD Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05400
Feature type CDS
Gene -
Product DUF1161 domain-containing protein
Location 1146196 - 1146429 (strand: 1)
Length 234 (nucleotides) / 77 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_767
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06649 Protein of unknown function (DUF1161)

Protein Sequence

MKKLIAVSTVLFALVPAMAQASCESVTEEISQKIISNGVPADGFTLTVVPAESAAQAEGQVVGNCDNETQNIIYLRK

Flanking regions ( +/- flanking 50bp)

GGACGTGAAGTTACTTCAGGTTGGAAGTAGTAAACATTTAAGGAAAAATGATGAAAAAACTGATTGCGGTTAGTACGGTACTTTTTGCGCTTGTCCCTGCAATGGCACAAGCTTCCTGTGAAAGTGTCACGGAAGAAATTTCGCAAAAAATCATCAGTAATGGTGTGCCTGCTGACGGCTTTACCTTAACCGTGGTGCCTGCGGAAAGCGCAGCACAGGCTGAAGGTCAGGTTGTGGGTAACTGTGACAATGAAACGCAGAATATTATCTATCTTCGCAAATAATTCGTAAATAACATTACGCAGTCAATACTCCGTAATGTAGTTAATGAATG