Homologs in group_691

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02915 FBDBKF_02915 56.8 Morganella morganii S1 ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
EHELCC_03385 EHELCC_03385 56.8 Morganella morganii S2 ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
NLDBIP_00075 NLDBIP_00075 56.8 Morganella morganii S4 ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
LHKJJB_01960 LHKJJB_01960 56.8 Morganella morganii S3 ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
HKOGLL_02000 HKOGLL_02000 56.8 Morganella morganii S5 ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada
F4V73_RS05360 F4V73_RS05360 57.0 Morganella psychrotolerans ada bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada

Distribution of the homologs in the orthogroup group_691

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_691

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06134 9.72e-89 271 47 1 263 1 ada Bifunctional transcriptional activator/DNA repair enzyme Ada Escherichia coli (strain K12)
P26189 2.25e-81 252 46 1 270 3 ada Regulatory protein ada Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P19220 1.87e-27 107 34 1 158 1 adaB Methylated-DNA--protein-cysteine methyltransferase, inducible Bacillus subtilis (strain 168)
Q5UNU9 7.42e-27 105 53 1 88 3 MGMT Probable methylated-DNA--protein-cysteine methyltransferase Acanthamoeba polyphaga mimivirus
P9WJW5 7.51e-26 103 54 0 87 1 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJW4 7.51e-26 103 54 0 87 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A697 7.51e-26 103 54 0 87 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P52982 4.09e-25 101 44 0 111 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium leprae (strain TN)
Q6BVY4 1.14e-24 100 33 5 178 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q46EW4 1.38e-24 99 35 2 162 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q6CPW2 9.55e-24 98 48 0 84 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q8PY44 1.14e-23 97 38 2 150 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9ZET8 1.98e-23 97 48 0 86 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P26188 2.71e-23 97 43 1 97 1 MGT1 Methylated-DNA--protein-cysteine methyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8TI34 3.51e-23 95 34 3 163 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5A0Y8 3.96e-23 96 34 4 167 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
A6ZXD3 6.05e-23 96 43 1 97 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Saccharomyces cerevisiae (strain YJM789)
A5E7M8 9.42e-23 96 49 2 89 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q6FNR0 1.86e-21 92 30 3 180 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P11742 3.6e-21 90 33 2 148 1 ogt Methylated-DNA--protein-cysteine methyltransferase, constitutive Bacillus subtilis (strain 168)
A3LZM4 6.84e-21 90 50 1 82 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
P0AFH1 1.08e-20 89 45 0 91 3 ogt Methylated-DNA--protein-cysteine methyltransferase Shigella flexneri
P0AFH0 1.08e-20 89 45 0 91 1 ogt Methylated-DNA--protein-cysteine methyltransferase Escherichia coli (strain K12)
P44687 1.63e-19 87 44 0 88 3 ogt Methylated-DNA--protein-cysteine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2U0 3.62e-19 85 46 0 84 3 ogt Methylated-DNA--protein-cysteine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2U1 3.62e-19 85 46 0 84 3 ogt Methylated-DNA--protein-cysteine methyltransferase Salmonella typhi
C3N9B4 1.72e-14 72 33 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MUC6 1.72e-14 72 33 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MKT6 1.72e-14 72 33 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KKV8 1.72e-14 72 33 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Q97VW7 1.72e-14 72 33 6 153 1 ogt Methylated-DNA--protein-cysteine methyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C3N1B4 2.5e-14 72 33 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.16.27)
Q6TDU1 1.14e-13 72 34 4 129 2 MGMT Methylated-DNA--protein-cysteine methyltransferase Canis lupus familiaris
C3NMY2 1.18e-13 70 32 6 153 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
O26715 1.26e-13 70 41 2 86 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P26187 2.1e-13 70 30 4 172 1 Mgmt Methylated-DNA--protein-cysteine methyltransferase Mus musculus
A4YH39 2.96e-13 69 37 2 90 3 ogt Methylated-DNA--protein-cysteine methyltransferase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q58924 3.55e-13 69 43 2 79 1 ogt Methylated-DNA--protein-cysteine methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P26186 4.04e-13 70 31 4 165 2 MGMT Methylated-DNA--protein-cysteine methyltransferase Cricetulus griseus
P24528 1.34e-12 68 33 2 127 1 Mgmt Methylated-DNA--protein-cysteine methyltransferase Rattus norvegicus
P16455 1.62e-12 68 36 0 95 1 MGMT Methylated-DNA--protein-cysteine methyltransferase Homo sapiens
C9RE37 4.32e-11 63 42 2 78 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7)
Q8TZ11 1.13e-10 61 34 2 90 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q973C7 2.55e-09 58 29 6 152 1 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O93728 1.68e-08 55 42 1 73 3 ogt Methylated-DNA--protein-cysteine methyltransferase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P0ACH8 1.79e-08 58 32 3 108 1 melR Melibiose operon regulatory protein Escherichia coli (strain K12)
P0ACH9 1.79e-08 58 32 3 108 3 melR Melibiose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q4J9C6 2.58e-07 52 27 4 151 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
O74023 3.3e-07 52 35 5 108 1 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O27970 3.48e-07 52 36 2 73 3 ogt Methylated-DNA--protein-cysteine methyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9UTN9 2.13e-06 48 40 0 62 1 atl1 Alkyltransferase-like protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0AFP3 4.64e-06 48 35 0 62 3 atl DNA base-flipping protein Shigella flexneri
P0AFP2 4.64e-06 48 35 0 62 1 atl DNA base-flipping protein Escherichia coli (strain K12)
C5A3L5 5.4e-06 49 37 5 91 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q6KZ38 7.36e-06 50 30 0 83 3 PTO1429 Bifunctional methyltransferase/endonuclease Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
O31449 2.57e-05 48 30 1 96 4 ybfI Uncharacterized HTH-type transcriptional regulator YbfI Bacillus subtilis (strain 168)
F0LIT8 3.83e-05 47 30 6 126 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus barophilus (strain DSM 11836 / MP)
C6A382 4.77e-05 46 31 5 130 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus sibiricus (strain DSM 12597 / MM 739)
O32071 7.54e-05 47 29 1 88 4 ytdP Uncharacterized HTH-type transcriptional regulator YtdP Bacillus subtilis (strain 168)
Q9HKY3 0.000117 46 34 0 63 3 Ta0460 Bifunctional methyltransferase/endonuclease Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q05587 0.000133 46 29 2 102 1 pocR Regulatory protein PocR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q97AL5 0.000168 46 26 0 83 3 TV0795 Bifunctional methyltransferase/endonuclease Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q5SI16 0.000622 42 31 3 77 1 TTHA1564 DNA base-flipping protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05985
Feature type CDS
Gene -
Product methylated-DNA--[protein]-cysteine S-methyltransferase
Location 1312855 - 1313718 (strand: 1)
Length 864 (nucleotides) / 287 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_691
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01035 6-O-methylguanine DNA methyltransferase, DNA binding domain
PF02870 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2169 Replication, recombination and repair (L) L Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10778 AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC:2.1.1.63] - -

Protein Sequence

MEKRHYQLIEQACRFIEENQGDVSLADIAAHIQSSPYYFHRRFKSIMGITPKEYANAYRHKLIKKALAGDKTITDAIYQSGFNANSRFYENATAILGMTPTHWRNGGQNIVIFFAVGICSLGHILVAQSEKGICAITLGDDPACLLEELQKQFPQAELVGANQEFEKLVAQVIGFVELPTQPLALPLDIQGTVFQQKVWRALLDIPFGCTMTYQEIAQKIGSPKSYRAVANACASNKLAVAIPCHRVIRQNGEISGYRWGIERKEKLLQREKSLHHQHDRLAISKSD

Flanking regions ( +/- flanking 50bp)

AGTTTATTGATAATGGACTTCATCCAGCATACATAAATGTAGGAACTAAAATGGAAAAGAGACATTATCAACTTATTGAACAAGCCTGCCGTTTTATTGAAGAAAATCAGGGTGATGTTTCTCTTGCCGACATCGCCGCACATATTCAATCCAGCCCATATTATTTCCATCGACGATTTAAATCTATAATGGGAATTACACCTAAAGAGTATGCGAATGCTTATCGGCACAAACTAATTAAGAAAGCATTAGCTGGCGATAAAACAATTACAGATGCGATATATCAATCAGGCTTTAATGCGAATAGCCGATTTTATGAAAATGCGACAGCCATATTAGGTATGACGCCAACCCATTGGCGCAATGGTGGACAAAATATCGTGATTTTTTTTGCTGTAGGGATCTGCTCATTAGGCCATATCCTTGTAGCTCAAAGTGAAAAGGGCATTTGTGCGATAACACTTGGCGATGATCCTGCGTGTTTATTAGAAGAATTACAAAAACAATTTCCTCAAGCTGAACTTGTTGGTGCAAACCAAGAGTTTGAAAAATTGGTTGCCCAAGTCATTGGTTTTGTTGAACTGCCAACACAACCTTTGGCATTACCACTTGATATTCAAGGAACAGTATTTCAACAAAAAGTTTGGCGGGCATTATTAGATATTCCTTTTGGTTGTACCATGACATATCAAGAAATTGCTCAAAAAATTGGTTCGCCAAAATCTTATCGAGCAGTGGCGAATGCCTGTGCATCAAATAAACTAGCAGTGGCGATCCCTTGCCATCGAGTTATCAGACAAAATGGTGAAATATCTGGATATCGTTGGGGGATTGAGCGCAAAGAAAAATTATTACAAAGAGAAAAATCCCTTCATCATCAGCATGATAGATTGGCTATTAGCAAGAGCGATTAACCGTTATAATAAACATAATATCAATTTATAACAGATGAAATAAAATGGCA