Homologs in group_760

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03420 FBDBKF_03420 63.6 Morganella morganii S1 kdpE two-component system response regulator KdpE
EHELCC_07115 EHELCC_07115 63.6 Morganella morganii S2 kdpE two-component system response regulator KdpE
NLDBIP_07440 NLDBIP_07440 63.6 Morganella morganii S4 kdpE two-component system response regulator KdpE
LHKJJB_06975 LHKJJB_06975 63.6 Morganella morganii S3 kdpE two-component system response regulator KdpE
HKOGLL_03955 HKOGLL_03955 63.6 Morganella morganii S5 kdpE two-component system response regulator KdpE
F4V73_RS11480 F4V73_RS11480 63.1 Morganella psychrotolerans kdpE two-component system response regulator KdpE

Distribution of the homologs in the orthogroup group_760

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_760

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21866 8.8e-105 305 63 0 222 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P9WGN1 1.23e-70 218 47 1 221 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.23e-70 218 47 1 221 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WGL9 2.59e-49 164 39 1 223 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 2.59e-49 164 39 1 223 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 2.59e-49 164 39 1 223 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1TEL7 6.76e-49 162 41 3 224 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9F868 1.01e-48 162 39 1 224 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0R3I8 9.62e-48 160 41 3 220 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8CQK0 2.26e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 2.26e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A216 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.31e-47 159 37 1 224 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.31e-47 159 37 1 224 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.31e-47 159 37 1 224 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.31e-47 159 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4LAJ9 3.45e-47 158 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P37478 1.12e-46 157 37 1 224 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q2FWH6 1.18e-46 157 40 3 223 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
L7N689 1.22e-46 157 38 3 228 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q742C1 1.23e-46 157 41 3 220 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.23e-46 157 41 3 220 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q1B3X8 1.88e-46 156 41 3 223 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.88e-46 156 41 3 223 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.88e-46 156 41 3 223 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q4A160 2.01e-46 156 37 1 224 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8DPL7 5.01e-46 155 38 1 226 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 5.01e-46 155 38 1 226 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 5.01e-46 155 38 1 226 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P32040 1.19e-45 155 39 3 234 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A0PWB4 4.2e-45 153 40 3 222 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
A1KHB7 5.2e-45 152 40 3 220 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 5.2e-45 152 40 3 220 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 8.19e-45 152 40 3 220 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 8.19e-45 152 40 3 220 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 8.19e-45 152 40 3 220 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P0C001 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 6.12e-44 149 41 3 219 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 6.12e-44 149 41 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q9CD68 1.01e-43 149 40 4 221 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P54884 1.48e-43 148 43 1 179 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q4L6C6 7.5e-43 147 40 3 222 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q99U73 2.38e-42 145 39 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P13792 6.28e-42 145 36 2 230 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P39663 6.94e-42 145 39 4 231 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O34903 1.37e-41 144 39 3 225 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P54443 3.93e-41 143 37 3 228 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P42244 3.98e-41 142 34 1 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
O78428 1.77e-39 139 36 2 231 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q47456 6.29e-39 137 39 3 219 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P94504 6.66e-39 137 33 3 230 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q82EB1 2.53e-38 135 35 2 233 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P0DMK7 2.53e-38 135 38 2 218 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.53e-38 135 38 2 218 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q9ZEP4 2.68e-38 135 37 3 232 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q06239 3.42e-38 135 35 3 226 3 vanR Regulatory protein VanR Enterococcus faecium
O69730 3.91e-38 135 34 3 227 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q49XM7 5.34e-38 134 39 3 219 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9TLQ4 1.19e-37 134 34 2 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q04942 1.35e-37 133 36 1 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P76340 1.51e-37 133 34 2 223 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P48259 1.62e-37 134 35 2 227 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q83RR0 1.85e-37 133 35 4 222 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.85e-37 133 35 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 1.95e-37 133 35 4 222 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q44006 3.17e-37 132 36 2 222 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P51358 3.3e-37 133 35 2 227 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q8X738 6.79e-37 132 35 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q1XDC9 6.85e-37 132 35 2 228 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P9WGM1 1.23e-36 131 36 3 204 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.23e-36 131 36 3 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.23e-36 131 36 3 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5HPC3 1.79e-36 130 39 3 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q52990 2.16e-36 130 37 3 222 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P28257 2.21e-36 131 35 2 227 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q50136 2.4e-36 130 35 3 204 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q8CP82 3.23e-36 130 39 3 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q02540 3.32e-36 130 36 3 220 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P28835 3.45e-36 130 33 2 232 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q31S42 3.77e-36 130 35 5 236 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q44929 7.94e-36 129 33 3 227 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P0ACZ8 1.22e-35 129 37 3 220 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.22e-35 129 37 3 220 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.22e-35 129 37 3 220 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P0AFJ5 1.81e-35 128 33 4 224 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.81e-35 128 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P35163 1.87e-35 128 32 3 227 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P45606 1.91e-35 128 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q70FH0 2.49e-35 127 38 3 219 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q8Z7H2 3.91e-35 127 33 4 224 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q9KM23 6.34e-35 127 36 4 225 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45607 6.83e-35 127 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P23620 7.77e-35 126 34 3 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DM78 9.52e-35 126 33 4 224 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 9.52e-35 126 33 4 224 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 9.52e-35 126 33 4 224 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 9.52e-35 126 33 4 224 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 9.52e-35 126 33 4 224 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9I0I1 1.07e-34 126 33 3 221 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0QTK2 1.97e-34 125 33 1 222 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q7A0U4 2e-34 125 32 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 2e-34 125 32 2 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 2e-34 125 32 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 2e-34 125 32 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 2e-34 125 32 2 227 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 2e-34 125 32 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 2e-34 125 32 2 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 2e-34 125 32 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P45605 2.58e-34 125 33 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q55890 3.69e-34 125 35 3 224 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q57QC3 4.27e-34 124 33 4 224 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P30843 5.77e-34 124 36 2 201 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P36556 1.01e-33 123 35 2 201 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HV32 1.73e-33 123 37 6 223 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P94413 3.27e-33 122 33 4 230 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q93CB8 5.14e-33 122 36 1 222 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 5.2e-33 122 36 1 222 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 5.2e-33 122 36 1 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 5.2e-33 122 36 1 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 7.01e-33 121 36 1 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P52076 8.47e-33 121 34 3 219 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q8XBS3 9.94e-33 120 34 3 219 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P0A4I0 1.81e-32 120 32 3 219 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.81e-32 120 32 3 219 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
A0A4P7TS68 3.05e-32 120 31 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.05e-32 120 31 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.05e-32 120 31 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.05e-32 120 31 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.05e-32 120 31 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.05e-32 120 31 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.05e-32 120 31 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.05e-32 120 31 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P45189 5.06e-32 119 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7A1J1 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 9.41e-32 118 29 3 223 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 9.41e-32 118 29 3 223 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 9.41e-32 118 29 3 223 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 9.41e-32 118 29 3 223 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 9.41e-32 118 29 3 223 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q8CQ17 1.7e-31 118 29 3 224 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 1.7e-31 118 29 3 224 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P44918 4.68e-31 117 32 3 231 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8GP20 1.42e-30 115 35 6 228 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q9K621 1.44e-30 115 30 2 221 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P31079 3.29e-30 115 31 4 235 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P66795 4.16e-30 114 33 3 219 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 4.16e-30 114 33 3 219 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q7D9K0 4.93e-30 115 34 3 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 4.93e-30 115 34 3 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZHD3 7.22e-30 114 36 6 223 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q9HUI2 1.4e-29 113 31 5 236 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P69228 3.47e-29 112 31 0 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 3.47e-29 112 31 0 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A6WZ81 6.67e-29 111 30 2 219 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q04803 7.04e-29 113 33 2 219 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O06978 7.58e-29 111 32 4 228 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
B8H358 9.75e-29 110 30 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 9.75e-29 110 30 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9I4F9 1.01e-28 110 32 3 207 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07783 1.14e-28 111 31 3 238 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q8FZ93 1.33e-28 110 30 2 219 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.33e-28 110 30 2 219 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.33e-28 110 30 2 219 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.33e-28 110 30 2 219 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.33e-28 110 30 2 219 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.33e-28 110 30 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.33e-28 110 30 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.33e-28 110 30 2 219 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P0A9Q4 1.72e-28 110 29 3 232 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.72e-28 110 29 3 232 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.72e-28 110 29 3 232 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.72e-28 110 29 3 232 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q5HLN2 5.42e-28 108 29 2 220 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A4H8 1.03e-27 108 31 6 229 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.03e-27 108 31 6 229 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8CQ37 1.18e-27 108 30 3 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.18e-27 108 30 3 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P42421 1.58e-27 107 30 4 227 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q8CN92 1.88e-27 107 29 2 220 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A0A0H3GGB5 1.97e-27 107 33 3 207 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q47744 3.56e-27 106 32 3 221 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q01473 2.2e-26 109 32 2 219 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 2.14e-09 60 28 1 121 3 rcaC Protein RcaC Microchaete diplosiphon
Q49VK3 2.72e-26 104 28 2 224 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O34951 2.96e-26 104 27 2 221 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P58357 3.25e-26 104 30 6 232 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q9AE24 9.61e-26 103 28 3 223 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q2YSS2 1.42e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z181 1.43e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.43e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.43e-25 102 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.43e-25 102 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.43e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
P0AE90 1.84e-25 102 32 2 206 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 1.84e-25 102 32 2 206 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 1.84e-25 102 32 2 206 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q49ZT8 1.85e-25 102 27 3 219 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O24973 1.85e-25 102 33 0 220 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q7A1L2 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.99e-25 102 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q932F1 2.48e-25 102 28 3 221 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P50351 2.68e-25 102 28 1 235 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q6GJ11 2.73e-25 101 28 3 221 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
P45337 2.78e-25 101 31 3 219 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38684 2.87e-25 102 29 6 232 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
Q4L481 2.97e-25 101 28 3 221 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P50350 4.94e-25 101 29 1 234 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q07597 4.96e-25 101 29 2 227 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q55933 6.21e-25 101 32 7 234 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P08368 6.74e-25 100 32 5 223 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P13359 7.85e-25 100 29 3 225 3 virG Regulatory protein VirG Rhizobium rhizogenes
P0CL17 1.3e-24 100 32 6 222 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.3e-24 100 32 6 222 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q2YZ24 7.19e-24 98 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
G3XCY6 1.55e-23 97 31 5 229 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7A039 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 2.34e-23 96 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4L8L9 4.04e-23 96 28 5 223 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
A6QJK3 6.77e-23 95 25 2 218 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 6.77e-23 95 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P52108 7.19e-23 95 28 4 233 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q6GE73 9.68e-23 95 25 2 218 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P0A4I2 1.45e-22 94 31 4 222 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.45e-22 94 31 4 222 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P07545 1.56e-22 95 34 3 175 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
O32192 5.14e-22 93 29 6 229 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
P44895 5.82e-22 93 28 2 201 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DN02 1.45e-20 89 27 4 222 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 1.45e-20 89 27 4 222 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P62722 3.57e-20 89 29 6 228 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P55701 1.21e-19 87 28 4 218 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q44444 5.4e-19 86 32 3 170 3 virG Regulatory protein VirG Rhizobium radiobacter
O31432 4.52e-18 82 30 8 233 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P33112 7.56e-18 82 27 3 221 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P39901 2.43e-16 73 66 0 48 5 ybfI Putative uncharacterized protein YbfI Escherichia coli (strain K12)
P40138 5.16e-14 73 33 3 142 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P46384 1.44e-13 68 31 1 120 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25918 2.51e-13 69 25 6 224 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P9WGM3 2.62e-13 69 37 3 121 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.62e-13 69 37 3 121 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q04849 5.14e-13 70 31 5 184 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q06065 7.22e-13 70 34 2 121 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P43501 5.51e-12 63 36 2 119 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GZM2 6.12e-12 67 34 2 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 6.12e-12 67 34 2 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P48359 7.47e-12 65 26 4 168 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P72781 9.78e-12 65 29 3 165 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KIY1 2.89e-11 65 37 2 112 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q24T61 3.84e-11 65 31 6 157 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
O29221 5.58e-11 64 30 2 127 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
T2KMF4 9.81e-11 64 28 4 153 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P28787 1.19e-10 63 28 1 126 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P0C5S3 1.78e-10 61 35 1 109 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
P24072 2.27e-10 59 29 2 119 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
A6UEL7 2.33e-10 61 35 1 109 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
Q54SP4 3.46e-10 62 33 2 112 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 1.12e-05 49 26 2 127 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q1XDE4 4.77e-10 60 28 1 128 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P51586 6.73e-10 58 33 1 114 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q2ILG8 1.04e-09 60 34 2 103 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
E0X9C7 1.06e-09 61 34 2 112 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
A5W4E3 1.48e-09 60 34 2 112 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P41789 1.82e-09 60 26 3 169 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1D359 1.96e-09 60 33 3 124 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
P23747 1.98e-09 60 36 2 122 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24086 2.58e-09 57 29 2 124 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 2.58e-09 57 29 2 124 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q05943 2.84e-09 59 28 4 171 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q88AQ2 3.81e-09 59 35 1 106 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9K998 4.37e-09 58 29 3 126 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88RJ6 5.59e-09 58 35 1 106 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P62640 6.7e-09 58 30 2 126 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P0AFB8 9.37e-09 58 26 3 169 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 9.37e-09 58 26 3 169 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P39048 1.04e-08 58 27 2 111 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q54YZ9 1.06e-08 58 31 1 119 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P52940 1.08e-08 57 32 3 131 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q1RJS1 1.09e-08 58 30 2 114 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
O82868 1.7e-08 55 32 1 109 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q10WZ6 1.79e-08 57 35 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q9HWA4 2.48e-08 56 29 2 113 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52936 2.93e-08 56 35 3 116 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P24908 3.27e-08 55 34 2 106 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZCY9 3.42e-08 56 29 2 114 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q4UL27 3.58e-08 56 29 2 114 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q39T95 3.61e-08 56 37 1 80 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7CQM5 4.34e-08 55 30 4 136 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O25153 4.51e-08 56 23 2 121 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
P96126 6.46e-08 53 27 3 122 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q92HC2 6.55e-08 55 28 2 114 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P09432 6.71e-08 55 30 1 115 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9APD9 6.79e-08 55 26 3 178 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q87MK5 7.27e-08 55 33 4 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2SFK0 9e-08 55 36 2 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q68WH4 9.26e-08 55 28 2 114 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9F8D7 9.37e-08 55 31 1 111 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P03029 9.83e-08 55 25 3 167 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q3ADA6 1.07e-07 55 32 3 114 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P48027 1.1e-07 55 33 3 112 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q0A9Z5 1.13e-07 55 30 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P52929 1.32e-07 53 32 4 126 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52938 1.34e-07 54 29 6 169 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q8X613 1.48e-07 54 27 1 129 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P52941 1.61e-07 53 27 5 165 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q53228 1.71e-07 53 30 1 107 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P52942 1.8e-07 51 28 1 115 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P62646 1.93e-07 54 27 5 141 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3ADG9 2.11e-07 53 29 3 141 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9KQD8 2.28e-07 53 32 4 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q00934 2.8e-07 53 33 3 121 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P14375 2.82e-07 53 26 1 129 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q30RX5 2.89e-07 53 40 1 60 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B0R4K1 2.92e-07 51 30 3 103 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q12YX1 3.05e-07 53 27 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q7MIQ5 3.18e-07 53 33 4 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q8DB67 3.18e-07 53 33 4 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q888V8 3.42e-07 53 27 4 134 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3IDZ3 3.57e-07 53 35 5 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
Q9KM66 3.62e-07 53 28 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4UU85 3.64e-07 53 31 3 131 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P0A4H5 3.76e-07 50 32 4 112 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.76e-07 50 32 4 112 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P96602 3.85e-07 52 35 3 100 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P58253 4.01e-07 53 33 4 118 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P10577 4.66e-07 53 25 5 192 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q8RAZ3 5e-07 53 30 3 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q48ND9 7.62e-07 52 26 4 134 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3J1W3 8.08e-07 52 33 2 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P25852 8.43e-07 52 27 2 136 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5A4X5 8.55e-07 52 28 2 129 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
P45671 8.73e-07 52 31 1 119 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P39486 8.94e-07 51 32 6 134 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
O87125 9.08e-07 52 34 3 105 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Z333 9.16e-07 52 27 2 136 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P96686 1.05e-06 51 25 2 116 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q8KLS5 1.16e-06 52 32 2 104 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
P52928 1.21e-06 51 24 4 167 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P0A4H2 1.21e-06 50 27 4 136 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.21e-06 50 27 4 136 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.21e-06 50 27 4 136 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q56312 1.23e-06 49 28 2 102 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0ACZ7 1.26e-06 50 26 3 138 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 1.26e-06 50 26 3 138 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 1.26e-06 50 26 3 138 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 1.26e-06 50 26 3 138 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
Q4ZYD3 1.29e-06 51 26 4 134 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
P0A4I4 1.44e-06 51 24 6 170 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.44e-06 51 24 6 170 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P42012 1.8e-06 50 25 4 166 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
A6X580 1.92e-06 48 23 1 119 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
O49397 1.98e-06 51 30 1 107 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P42508 2.05e-06 50 28 1 107 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P31802 2.05e-06 50 33 3 121 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q1IQS9 2.32e-06 50 28 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
O33558 2.72e-06 50 35 3 87 1 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Cereibacter sphaeroides
Q86AT9 2.81e-06 51 23 3 139 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q3J653 3.31e-06 50 35 3 87 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P0C5S5 3.45e-06 50 27 1 122 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 3.45e-06 50 27 1 122 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q87MX7 3.52e-06 50 27 1 122 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0AFU5 3.55e-06 50 28 3 163 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 3.55e-06 50 28 3 163 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q88EW5 3.63e-06 50 35 1 78 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q15RF6 3.82e-06 50 32 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
O34534 4.07e-06 49 24 5 180 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
O52262 4.08e-06 50 35 1 78 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
P71403 4.26e-06 48 26 4 108 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q95PI2 4.47e-06 50 24 2 117 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q9ZM64 4.52e-06 47 26 4 108 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q9KT84 4.61e-06 50 35 2 88 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P62598 4.87e-06 50 29 1 107 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
O05251 5.09e-06 49 37 5 105 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q5E3S1 5.31e-06 50 31 4 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
O83639 5.35e-06 50 28 5 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q04848 5.98e-06 50 27 1 126 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8D0P1 6.04e-06 47 28 2 108 3 cheY Chemotaxis protein CheY Yersinia pestis
Q8KR08 6.2e-06 48 28 1 128 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P06628 6.27e-06 47 25 1 119 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q8H7S7 6.49e-06 50 33 5 112 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 6.49e-06 50 33 5 112 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
A1SMR4 6.66e-06 49 27 4 158 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q4KG36 6.85e-06 49 31 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q67P67 6.99e-06 49 28 2 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P10958 7.5e-06 48 24 1 129 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q2INL1 7.67e-06 49 40 0 64 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Anaeromyxobacter dehalogenans (strain 2CP-C)
P62638 8.18e-06 49 31 3 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5V0B3 8.35e-06 49 29 4 125 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P52932 8.44e-06 48 26 4 123 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q3LWR6 9.56e-06 48 27 1 128 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 9.56e-06 48 27 1 128 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 9.56e-06 48 27 1 128 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0AE69 1.02e-05 47 29 2 108 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.02e-05 47 29 2 108 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.02e-05 47 29 2 108 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P06534 1.06e-05 48 27 5 123 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q55169 1.06e-05 47 29 4 127 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94514 1.09e-05 48 28 4 121 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q8FGP6 1.09e-05 47 29 2 108 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9FAD7 1.11e-05 47 29 2 108 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q93P00 1.12e-05 47 28 2 108 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q4ZQV7 1.31e-05 48 31 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q8FW53 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 1.36e-05 46 23 1 117 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 1.36e-05 46 23 1 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q9HV27 1.43e-05 48 35 2 96 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3KFZ6 1.51e-05 48 31 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
A5VW00 1.52e-05 48 27 4 148 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P0AEV3 1.54e-05 48 32 1 100 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.54e-05 48 32 1 100 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.54e-05 48 32 1 100 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q48GG6 1.55e-05 48 31 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q47GX7 1.59e-05 48 31 4 112 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
P52931 1.61e-05 47 25 6 172 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q884V3 1.61e-05 48 31 2 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2KCH7 1.64e-05 46 28 2 115 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q940D0 1.8e-05 48 29 3 114 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q39QJ2 1.83e-05 48 29 2 102 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2SBX9 1.99e-05 48 31 2 98 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
P0A2D5 2.06e-05 46 28 2 108 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 2.06e-05 46 28 2 108 3 cheY Chemotaxis protein CheY Salmonella typhi
O07528 2.08e-05 47 39 1 66 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q3IRR4 2.32e-05 48 28 3 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P26275 2.42e-05 47 30 3 118 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2RRX2 2.44e-05 48 30 2 109 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P0AEC5 2.8e-05 48 31 5 106 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 2.8e-05 48 31 5 106 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 2.8e-05 48 31 5 106 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
P44845 2.94e-05 47 29 3 113 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FUS8 3.1e-05 47 26 4 149 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 3.1e-05 47 26 4 149 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 3.1e-05 47 26 4 149 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 3.1e-05 47 26 4 149 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q8EEQ0 3.1e-05 47 30 2 85 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KSB1 3.13e-05 47 28 2 118 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8TLG9 3.45e-05 47 33 2 101 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5A599 3.48e-05 47 27 6 165 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P18769 3.52e-05 47 29 2 111 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P26408 3.71e-05 47 29 3 118 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
P10576 3.71e-05 47 26 1 119 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P59342 3.73e-05 47 31 5 106 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P51343 4.09e-05 46 27 1 120 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P45709 4.27e-05 45 25 2 111 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q7MM78 4.57e-05 47 27 1 122 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 4.57e-05 47 27 1 122 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q6LTM2 4.95e-05 47 38 2 71 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
P45365 5.14e-05 47 27 1 119 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q0AWZ8 5.67e-05 47 25 4 138 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P38889 5.81e-05 47 27 1 108 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P58363 5.99e-05 47 32 2 115 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
P0AEC4 6.16e-05 47 32 2 115 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 6.16e-05 47 32 2 115 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
Q9ZWJ9 6.18e-05 47 27 3 136 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q9FXD6 6.51e-05 47 26 2 140 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q5GYV8 7.47e-05 46 28 3 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 7.47e-05 46 28 3 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q4UU97 7.47e-05 46 22 8 197 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 7.47e-05 46 22 8 197 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A7N6S2 7.53e-05 46 24 3 114 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q0HWY6 7.64e-05 46 32 1 78 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q0HKN5 8.75e-05 46 32 1 78 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q085K9 8.96e-05 46 35 1 65 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q3BUA2 9.85e-05 46 28 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 9.85e-05 46 28 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q2SPQ1 9.89e-05 46 29 5 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q9WY30 0.000112 45 26 2 118 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P52934 0.000112 45 31 3 87 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05915
Feature type CDS
Gene kdpE
Product two-component system response regulator KdpE
Location 1298782 - 1299465 (strand: -1)
Length 684 (nucleotides) / 227 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_760
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07667 two-component system, OmpR family, KDP operon response regulator KdpE Two-component system
Quorum sensing		 -

Protein Sequence

MTPYNILIVEDEKEILRFVRLALENEGFRVYDASECQRGLIEAASRKPDLVILDLGLPDKDGLCFIQDFRQWSSTPIIVLSARDSEQDKVDALDAGADDYLTKPFGMSELLARVRASLRRFVKQETETTQFTFGDITIDWVKRIVTRQGVPIHFTPTEFRLLSELVNNSGKVLTQRHLMQHVWGPNFVEHSHYLRIYMGHLRQKIETDPTCPVHLITETGIGYRFMP

Flanking regions ( +/- flanking 50bp)

GTTTTACCTTTAAAATCACTACCGAATATTGATGAGATTGAAATAAAACAGTGACGCCATATAACATATTGATTGTTGAAGATGAAAAAGAGATCTTACGATTCGTTCGCCTTGCATTAGAGAACGAAGGTTTTCGTGTTTATGACGCCTCAGAATGTCAACGAGGATTAATAGAAGCAGCATCAAGAAAACCTGATTTAGTCATTCTTGATCTGGGATTACCTGATAAAGATGGGCTTTGCTTTATTCAAGATTTCCGCCAATGGAGTAGCACGCCGATTATTGTGTTATCCGCCAGAGATTCTGAACAAGATAAAGTTGATGCTTTAGACGCTGGAGCTGATGATTATTTAACTAAACCCTTCGGTATGAGTGAATTACTAGCTCGGGTTCGTGCTTCATTACGTCGCTTTGTCAAACAAGAAACAGAAACGACTCAATTTACATTTGGTGATATCACTATTGATTGGGTTAAAAGAATAGTCACTCGCCAAGGCGTACCCATTCACTTTACTCCGACCGAATTTCGTCTACTCAGTGAACTTGTCAACAATAGTGGAAAAGTATTAACTCAACGTCATTTAATGCAGCATGTTTGGGGGCCTAACTTTGTAGAGCATAGCCATTATTTGCGAATTTATATGGGGCATCTACGTCAGAAAATAGAAACCGATCCCACCTGTCCAGTGCACTTAATTACTGAAACGGGGATCGGTTATCGTTTTATGCCTTAAGTCTCTTTTTTCGGTTTATCAGAACGACTAAGCCATTGCAGATATCGTTT