Homologs in group_741

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02395 FBDBKF_02395 81.3 Morganella morganii S1 uspE universal stress protein UspE
EHELCC_02865 EHELCC_02865 81.3 Morganella morganii S2 uspE universal stress protein UspE
NLDBIP_00595 NLDBIP_00595 81.3 Morganella morganii S4 uspE universal stress protein UspE
LHKJJB_01440 LHKJJB_01440 81.3 Morganella morganii S3 uspE universal stress protein UspE
HKOGLL_01480 HKOGLL_01480 81.3 Morganella morganii S5 uspE universal stress protein UspE
F4V73_RS04775 F4V73_RS04775 80.0 Morganella psychrotolerans uspE universal stress protein UspE

Distribution of the homologs in the orthogroup group_741

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_741

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P60005 0.0 522 77 0 309 3 uspE Universal stress protein E Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZE81 2.6e-174 488 71 1 316 3 uspE Universal stress protein E Yersinia pestis
Q8ZP84 1.83e-168 473 68 1 316 1 uspE Universal stress protein E Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z788 9.24e-168 471 68 1 316 3 uspE Universal stress protein E Salmonella typhi
P0AAC3 6.86e-166 466 67 1 316 3 uspE Universal stress protein E Shigella flexneri
P0AAC0 6.86e-166 466 67 1 316 1 uspE Universal stress protein E Escherichia coli (strain K12)
P0AAC1 6.86e-166 466 67 1 316 3 uspE Universal stress protein E Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAC2 6.86e-166 466 67 1 316 3 uspE Universal stress protein E Escherichia coli O157:H7
P44195 4.26e-99 297 48 3 304 1 uspE Universal stress protein E homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q83AC1 2.73e-05 47 26 3 115 3 uspA1 Universal stress protein A homolog 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P37903 7.79e-05 45 24 4 120 1 uspF Universal stress protein F Escherichia coli (strain K12)
P0A4P8 7.87e-05 45 24 4 120 3 uspF Universal stress protein F Shigella flexneri
P0A4P6 7.87e-05 45 24 4 120 3 uspF Universal stress protein F Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TI19 7.87e-05 45 24 4 120 3 uspF Universal stress protein F Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0A4P7 7.87e-05 45 24 4 120 3 uspF Universal stress protein F Escherichia coli O157:H7
Q57951 0.000104 45 36 0 58 3 MJ0531 Universal stress protein MJ0531 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P67091 0.000205 44 25 4 120 1 uspF Universal stress protein F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67092 0.000205 44 25 4 120 3 uspF Universal stress protein F Salmonella typhi
Q2FXL6 0.000264 44 22 4 153 3 SAOUHSC_01819 Putative universal stress protein SAOUHSC_01819 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GFZ7 0.000264 44 22 4 153 3 SAR1788 Putative universal stress protein SAR1788 Staphylococcus aureus (strain MRSA252)
Q5HF64 0.000264 44 22 4 153 3 SACOL1759 Putative universal stress protein SACOL1759 Staphylococcus aureus (strain COL)
Q99TF3 0.000264 44 22 4 153 3 SAV1710 Putative universal stress protein SAV1710 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FG28 0.000264 44 22 4 153 3 SAUSA300_1656 Putative universal stress protein SAUSA300_1656 Staphylococcus aureus (strain USA300)
Q7A0N0 0.000264 44 22 4 153 3 MW1653 Putative universal stress protein MW1653 Staphylococcus aureus (strain MW2)
Q6G8L7 0.000264 44 22 4 153 3 SAS1637 Putative universal stress protein SAS1637 Staphylococcus aureus (strain MSSA476)
Q2YTD0 0.000264 44 22 4 153 3 SAB1569 Putative universal stress protein SAB1569 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A551 0.000264 44 22 4 153 1 SA1532 Putative universal stress protein SA1532 Staphylococcus aureus (strain N315)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05800
Feature type CDS
Gene uspE
Product universal stress protein UspE
Location 1268218 - 1269168 (strand: -1)
Length 951 (nucleotides) / 316 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_741
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00582 Universal stress protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0589 Signal transduction mechanisms (T) T Nucleotide-binding universal stress protein, UspA family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K14055 universal stress protein E - -

Protein Sequence

MEKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHDKLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGLSAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPITVDSDNE

Flanking regions ( +/- flanking 50bp)

TATCTTTAAAAATGTAGATGGATAAATCCAGCCCTAAAGAGGATATAGCAATGGAAAAATATCAAAACCTTCTCGTTGTCATTGATCCTAACCAAGATGACCAACCAGCACTACGTCGTGCTGTTTATATCGTTCAGCGTAATGGTGGGCGGATAAAAGCTTTTCTACCTGTTTATGATCTCTCATATGACATGACCACCCTTTTATCTCCCGATGAACGTAATGCGATGCGCAAAGGCGTGATTAATCAAAAAACCGCTTGGATAAAACAGCAAGCTCGCTATTATCTTGAAGCCGGCATTCAAATCGACATAAAAGTGATTTGGCATAACCGACCGTATGAAGCCATTATTGAAGAAGTGATCACCGATAAGCATGACTTACTGATTAAAATGGCTCATCAACATGATAAGTTAGGCTCCTTAATTTTTACTCCCCTAGATTGGCAATTGTTAAGAAAATGCCCTGCTCCTGTATGGATGGTAAAAGATAAAGAGTGGCCAGAATACGGCACTATTGTTGTCGCCGCTAATCTGTCCAATGAAGAGTCATATCATGATGCATTAAATTTAAAGTTAATTGAATTAACAAACGATTTATCTCACCGTATACAAAAAGATCCCGACGTTCATTTACTCAGTGCCTACCCTGTTGCACCCATTAATATTGCAATTGAGTTACCTGACTTTGATCCTAACCTTTATAACAATGCTTTGCGTGGACAACACCTTATAGCGATGAAAGAGCTTCGCCAGAAATTCTCTATTCCTGAGGAAAAAACACATGTCAAAGAAGGATTGCCTGAGCAAGTTATCCCTCAAGTATGCGAAGAGCTAAATGCGGGTATTGTCGTATTAGGTATTTTAGGGAGAACTGGACTTTCTGCCGCTTTCTTAGGCAATACAGCAGAACAGCTGATCGACCATATAAAATGTGATTTACTCGCTATCAAACCTGATGGCTTTACCTGTCCTATCACTGTCGATTCAGACAACGAATAACGCTTTTAATACTGTATAACAAAACGCCCGCTATCACTTAAATAGTCGGG