Homologs in group_728

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02250 FBDBKF_02250 69.1 Morganella morganii S1 ycgL UPF0745 protein
EHELCC_02720 EHELCC_02720 69.1 Morganella morganii S2 ycgL UPF0745 protein
NLDBIP_00740 NLDBIP_00740 69.1 Morganella morganii S4 ycgL UPF0745 protein
LHKJJB_01295 LHKJJB_01295 69.1 Morganella morganii S3 ycgL UPF0745 protein
HKOGLL_01335 HKOGLL_01335 69.1 Morganella morganii S5 ycgL UPF0745 protein
F4V73_RS04620 F4V73_RS04620 67.4 Morganella psychrotolerans - YcgL domain-containing protein

Distribution of the homologs in the orthogroup group_728

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_728

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVV8 9.91e-66 195 100 0 95 3 PMI1171 YcgL domain-containing protein PMI1171 Proteus mirabilis (strain HI4320)
A1JRB1 1.01e-44 142 75 0 89 3 YE2368 YcgL domain-containing protein YE2368 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9QYV1 4.89e-44 140 74 0 89 3 YpAngola_A2398 YcgL domain-containing protein YpAngola_A2398 Yersinia pestis bv. Antiqua (strain Angola)
B2K3P0 4.89e-44 140 74 0 89 3 YPTS_2123 YcgL domain-containing protein YPTS_2123 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLI7 4.89e-44 140 74 0 89 3 YPK_2120 YcgL domain-containing protein YPK_2120 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q7CID0 4.89e-44 140 74 0 89 3 YPO2080 YcgL domain-containing protein YPO2080/y2231/YP_1923 Yersinia pestis
Q66AR8 4.89e-44 140 74 0 89 3 YPTB2062 YcgL domain-containing protein YPTB2062 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FIA4 4.89e-44 140 74 0 89 3 YpsIP31758_2009 YcgL domain-containing protein YpsIP31758_2009 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CJE4 4.89e-44 140 74 0 89 3 YPN_1556 YcgL domain-containing protein YPN_1556 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C7Z3 4.89e-44 140 74 0 89 3 YPA_1462 YcgL domain-containing protein YPA_1462 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TJI0 4.89e-44 140 74 0 89 3 YPDSF_1042 YcgL domain-containing protein YPDSF_1042 Yersinia pestis (strain Pestoides F)
Q7N521 6.88e-43 137 65 0 88 3 plu2139 YcgL domain-containing protein plu2139 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DG39 1.07e-42 137 74 0 83 3 PC1_1941 YcgL domain-containing protein PC1_1941 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4M3 2.91e-42 135 74 0 83 3 ECA2367 YcgL domain-containing protein ECA2367 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GFG6 6.97e-42 135 67 0 87 3 Spro_2755 YcgL domain-containing protein Spro_2755 Serratia proteamaculans (strain 568)
B7LSK4 1.59e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N3Y3 2.31e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1RCR7 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli (strain UTI89 / UPEC)
B1LHY8 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli (strain SMS-3-5 / SECEC)
P0AB43 2.97e-41 134 69 0 85 1 ycgL Protein YcgL Escherichia coli (strain K12)
P0AB44 2.97e-41 134 69 0 85 1 ycgL Protein YcgL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIJ6 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AAA3 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O1:K1 / APEC
B1XA66 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli (strain K12 / DH10B)
C4ZTM0 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli (strain K12 / MC4100 / BW2952)
B7MTV7 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O81 (strain ED1a)
B7NJG3 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YXK3 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB45 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O157:H7
B7MK76 2.97e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQ64 3.42e-41 134 69 0 85 3 ycgL Protein YcgL Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A6TAX2 6.26e-41 132 67 0 87 3 KPN78578_22820 YcgL domain-containing protein KPN78578_22820 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQ72 2.78e-40 131 66 0 87 3 KPK_1976 YcgL domain-containing protein KPK_1976 Klebsiella pneumoniae (strain 342)
Q83LF2 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Shigella flexneri
Q0T5M1 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Shigella flexneri serotype 5b (strain 8401)
Q322F8 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Shigella boydii serotype 4 (strain Sb227)
B2TZA6 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I9N9 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli (strain SE11)
B1IUB2 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZB3 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli O9:H4 (strain HS)
B7LX92 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli O8 (strain IAI1)
B7LGT7 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli (strain 55989 / EAEC)
A7ZKV0 4.12e-40 131 68 0 85 3 ycgL Protein YcgL Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z2X0 4.45e-40 131 68 0 85 3 ycgL Protein YcgL Shigella sonnei (strain Ss046)
A8AFR0 4.75e-40 130 67 0 85 3 CKO_01183 YcgL domain-containing protein CKO_01183 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32H41 5.73e-40 130 68 0 85 3 ycgL Protein YcgL Shigella dysenteriae serotype 1 (strain Sd197)
A4WBF9 3.3e-39 128 65 1 91 3 Ent638_2370 YcgL domain-containing protein Ent638_2370 Enterobacter sp. (strain 638)
B4SUK6 7.08e-39 128 62 0 88 3 ycgL Protein YcgL Salmonella newport (strain SL254)
B4TXY3 7.65e-39 128 62 0 88 3 ycgL Protein YcgL Salmonella schwarzengrund (strain CVM19633)
B5F3S9 8.27e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella agona (strain SL483)
Q8ZP11 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q322 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella paratyphi C (strain RKS4594)
A9MVV4 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TKE4 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella heidelberg (strain SL476)
B5R8Y8 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2V7 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella enteritidis PT4 (strain P125109)
B5FTM0 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella dublin (strain CT_02021853)
Q57NJ9 8.35e-39 127 62 0 88 3 ycgL Protein YcgL Salmonella choleraesuis (strain SC-B67)
A7MNK1 1.23e-38 127 63 0 88 3 ESA_01460 YcgL domain-containing protein ESA_01460 Cronobacter sakazakii (strain ATCC BAA-894)
Q8Z681 2.98e-38 126 61 0 88 3 ycgL Protein YcgL Salmonella typhi
A9MP50 3.25e-38 126 62 0 88 3 ycgL Protein YcgL Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BHE3 5.62e-38 125 61 0 88 3 ycgL Protein YcgL Salmonella paratyphi A (strain AKU_12601)
Q5PCU0 5.62e-38 125 61 0 88 3 ycgL Protein YcgL Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B2VJ45 2.18e-36 121 60 0 87 3 ETA_15380 YcgL domain-containing protein ETA_15380 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NTB3 3.02e-31 108 53 0 90 3 SG1337 YcgL domain-containing protein SG1337 Sodalis glossinidius (strain morsitans)
Q6LT85 4.21e-31 107 55 1 84 3 PBPRA1080 YcgL domain-containing protein PBPRA1080 Photobacterium profundum (strain SS9)
Q47YC9 3.34e-30 105 51 0 84 3 CPS_3517 YcgL domain-containing protein CPS_3517 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9KQP1 5.97e-30 105 54 1 84 3 VC_1957 YcgL domain-containing protein VC_1957 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6U8 9.15e-30 104 54 1 84 3 VC0395_A1544 YcgL domain-containing protein VC0395_A1544/VC395_2072 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B1KDK2 1.68e-29 103 49 0 91 3 Swoo_2115 YcgL domain-containing protein Swoo_2115 Shewanella woodyi (strain ATCC 51908 / MS32)
Q3ICF9 4.61e-29 102 48 0 82 3 PSHAb0508 YcgL domain-containing protein PSHAb0508 Pseudoalteromonas translucida (strain TAC 125)
B0TRI4 5.25e-29 102 47 0 88 3 Shal_1837 YcgL domain-containing protein Shal_1837 Shewanella halifaxensis (strain HAW-EB4)
A8H5C6 1.49e-28 101 46 0 88 3 Spea_2443 YcgL domain-containing protein Spea_2443 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B5FFP4 1.55e-28 101 52 1 84 3 VFMJ11_1829 YcgL domain-containing protein VFMJ11_1829 Aliivibrio fischeri (strain MJ11)
Q12NR2 1.92e-28 101 51 0 84 3 Sden_1630 YcgL domain-containing protein Sden_1630 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5E448 2e-28 100 52 1 84 3 VF_1703 YcgL domain-containing protein VF_1703 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B8CNS1 2.04e-28 101 50 0 84 3 swp_2294 YcgL domain-containing protein swp_2294 Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QF01 2.9e-28 100 49 0 91 3 Shew_2183 YcgL domain-containing protein Shew_2183 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q87RC2 5.16e-28 100 52 2 95 3 VP0875 YcgL domain-containing protein VP0875 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MMK9 7.43e-28 99 51 1 84 3 VV1058 YcgL domain-containing protein VV1058 Vibrio vulnificus (strain YJ016)
A1S6X8 8.33e-28 99 47 0 88 3 Sama_1929 YcgL domain-containing protein Sama_1929 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8DFS5 1.22e-27 99 51 1 84 3 VV1_0131 YcgL domain-containing protein VV1_0131 Vibrio vulnificus (strain CMCP6)
B6EIV9 2.77e-27 98 50 2 94 3 VSAL_I1068 YcgL domain-containing protein VSAL_I1068 Aliivibrio salmonicida (strain LFI1238)
A7MT10 2.95e-27 98 50 2 95 3 VIBHAR_01387 YcgL domain-containing protein VIBHAR_01387 Vibrio campbellii (strain ATCC BAA-1116)
A4SMV9 1.91e-26 96 45 0 91 3 ASA_2166 YcgL domain-containing protein ASA_2166 Aeromonas salmonicida (strain A449)
Q15S25 2.79e-26 95 44 0 85 3 Patl_2802 YcgL domain-containing protein Patl_2802 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B7VL66 3.1e-26 95 52 1 76 3 VS_0884 YcgL domain-containing protein VS_0884 Vibrio atlanticus (strain LGP32)
A0KK58 5.03e-26 95 44 0 89 3 AHA_2135 YcgL domain-containing protein AHA_2135 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KXU1 1.01e-25 94 44 0 88 3 Shewana3_2381 YcgL domain-containing protein Shewana3_2381 Shewanella sp. (strain ANA-3)
Q083H7 1.44e-25 94 46 0 88 3 Sfri_1738 YcgL domain-containing protein Sfri_1738 Shewanella frigidimarina (strain NCIMB 400)
B0BNZ2 3.06e-25 93 46 0 86 3 APJL_0712 YcgL domain-containing protein APJL_0712 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXE7 3.13e-25 93 46 0 86 3 APP7_0754 YcgL domain-containing protein APP7_0754 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N076 3.13e-25 93 46 0 86 3 APL_0712 YcgL domain-containing protein APL_0712 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0HUG8 4.36e-25 92 46 0 81 3 Shewmr7_2249 YcgL domain-containing protein Shewmr7_2249 Shewanella sp. (strain MR-7)
Q0HI72 4.36e-25 92 46 0 81 3 Shewmr4_2172 YcgL domain-containing protein Shewmr4_2172 Shewanella sp. (strain MR-4)
A1STV0 4.83e-25 92 43 0 95 3 Ping_1076 YcgL domain-containing protein Ping_1076 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8FWA2 6.3e-25 92 43 0 91 3 Ssed_2518 YcgL domain-containing protein Ssed_2518 Shewanella sediminis (strain HAW-EB3)
A1RK88 1.29e-24 91 44 0 81 3 Sputw3181_2259 YcgL domain-containing protein Sputw3181_2259 Shewanella sp. (strain W3-18-1)
A4Y6A8 1.29e-24 91 44 0 81 3 Sputcn32_1766 YcgL domain-containing protein Sputcn32_1766 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EE15 1.5e-24 91 43 0 88 3 SO_2575 YcgL domain-containing protein SO_2575 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8F3G5 5.06e-24 90 48 0 80 3 HAPS_0171 YcgL domain-containing protein HAPS_0171 Glaesserella parasuis serovar 5 (strain SH0165)
C1DPN1 6.84e-24 89 50 0 87 3 Avin_32960 YcgL domain-containing protein Avin_32960 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8E7F9 1.25e-23 89 43 0 81 3 Sbal223_2423 YcgL domain-containing protein Sbal223_2423 Shewanella baltica (strain OS223)
A9KYY6 1.25e-23 89 43 0 81 3 Sbal195_1903 YcgL domain-containing protein Sbal195_1903 Shewanella baltica (strain OS195)
A6WMK0 1.25e-23 89 43 0 81 3 Shew185_1896 YcgL domain-containing protein Shew185_1896 Shewanella baltica (strain OS185)
A3D3R2 1.25e-23 89 43 0 81 3 Sbal_1869 YcgL domain-containing protein Sbal_1869 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B3PKG9 2.53e-23 88 53 0 75 3 CJA_2437 YcgL domain-containing protein CJA_2437 Cellvibrio japonicus (strain Ueda107)
Q0I3R1 3.47e-23 87 46 0 81 3 HS_0805 YcgL domain-containing protein HS_0805 Histophilus somni (strain 129Pt)
B0UTZ7 3.47e-23 87 46 0 81 3 HSM_1274 YcgL domain-containing protein HSM_1274 Histophilus somni (strain 2336)
B4RU89 6.12e-23 87 41 0 92 3 MADE_1012200 YcgL domain-containing protein MADE_1012200 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7VLP9 9.75e-23 87 44 0 84 3 HD_1373 YcgL domain-containing protein HD_1373 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VP52 4.31e-22 85 50 0 74 3 Asuc_1390 YcgL domain-containing protein Asuc_1390 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65TQ6 4.83e-22 85 42 0 89 3 MS1047 YcgL domain-containing protein MS1047 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44198 3.04e-21 82 40 1 89 3 HI_1446 YcgL domain-containing protein HI_1446 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEW3 4.7e-21 82 40 1 89 3 CGSHiGG_01115 YcgL domain-containing protein CGSHiGG_01115 Haemophilus influenzae (strain PittGG)
Q9CNI7 6.65e-21 82 47 0 74 3 PM0444 YcgL domain-containing protein PM0444 Pasteurella multocida (strain Pm70)
A5UC58 8.39e-21 81 40 1 89 3 CGSHiEE_04830 YcgL domain-containing protein CGSHiEE_04830 Haemophilus influenzae (strain PittEE)
Q4QKH3 8.39e-21 81 40 1 89 3 NTHI1684 YcgL domain-containing protein NTHI1684 Haemophilus influenzae (strain 86-028NP)
Q21L28 1.36e-20 81 42 1 90 3 Sde_1339 YcgL domain-containing protein Sde_1339 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4VJA8 9.59e-20 79 46 0 75 3 PST_1364 YcgL domain-containing protein PST_1364 Stutzerimonas stutzeri (strain A1501)
Q5QWP6 1.25e-19 78 41 0 80 3 IL1825 YcgL domain-containing protein IL1825 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B4SMZ6 2.46e-19 78 41 0 86 3 Smal_3906 YcgL domain-containing protein Smal_3906 Stenotrophomonas maltophilia (strain R551-3)
A4XT72 3.15e-19 78 43 0 87 3 Pmen_1774 YcgL domain-containing protein Pmen_1774 Pseudomonas mendocina (strain ymp)
Q02JD6 1.08e-18 76 40 0 87 3 PA14_47450 YcgL domain-containing protein PA14_47450 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V8R5 1.08e-18 76 40 0 87 3 PSPA7_4096 YcgL domain-containing protein PSPA7_4096 Pseudomonas aeruginosa (strain PA7)
B7UW25 1.08e-18 76 40 0 87 3 PLES_38871 YcgL domain-containing protein PLES_38871 Pseudomonas aeruginosa (strain LESB58)
Q1I6K3 1.12e-18 76 42 0 87 3 PSEEN4034 YcgL domain-containing protein PSEEN4034 Pseudomonas entomophila (strain L48)
Q9I449 1.99e-18 75 40 0 87 3 PA1295 YcgL domain-containing protein PA1295 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B2FN98 2.44e-18 75 40 0 86 3 Smlt4554 YcgL domain-containing protein Smlt4554 Stenotrophomonas maltophilia (strain K279a)
B0KSS4 3.71e-18 75 45 0 74 3 PputGB1_4120 YcgL domain-containing protein PputGB1_4120 Pseudomonas putida (strain GB-1)
Q31J39 4.98e-18 75 40 0 75 3 Tcr_0238 YcgL domain-containing protein Tcr_0238 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q87Y82 5.2e-18 75 47 0 74 3 PSPTO_3921 YcgL domain-containing protein PSPTO_3921 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48LC5 7.06e-18 74 47 0 74 3 PSPPH_1548 YcgL domain-containing protein PSPPH_1548 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4KGL0 8.04e-18 74 43 0 74 3 PFL_1496 YcgL domain-containing protein PFL_1496 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5VZZ9 1.09e-17 74 45 0 74 3 Pput_1298 YcgL domain-containing protein Pput_1298 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0VDY4 1.2e-17 74 39 2 91 3 ABAYE1960 YcgL domain-containing protein ABAYE1960 Acinetobacter baumannii (strain AYE)
B0VPM5 1.2e-17 74 39 2 91 3 ABSDF1923 YcgL domain-containing protein ABSDF1923 Acinetobacter baumannii (strain SDF)
B7I5W1 1.2e-17 74 39 2 91 3 AB57_1916 YcgL domain-containing protein AB57_1916 Acinetobacter baumannii (strain AB0057)
B7H3B2 1.2e-17 74 39 2 91 3 ABBFA_001807 YcgL domain-containing protein ABBFA_001807 Acinetobacter baumannii (strain AB307-0294)
B2I0B1 1.2e-17 74 39 2 91 3 ACICU_01724 YcgL domain-containing protein ACICU_01724 Acinetobacter baumannii (strain ACICU)
A3M5C1 1.2e-17 74 39 2 91 3 A1S_1688 YcgL domain-containing protein A1S_1688 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q4ZW60 1.45e-17 73 45 0 74 3 Psyr_1564 YcgL domain-containing protein Psyr_1564 Pseudomonas syringae pv. syringae (strain B728a)
Q88E76 1.76e-17 73 45 0 74 3 PP_4590 YcgL domain-containing protein PP_4590 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C3K5F2 7.68e-17 72 43 0 74 3 PFLU_1517 YcgL domain-containing protein PFLU_1517 Pseudomonas fluorescens (strain SBW25)
A6VYC0 8.47e-17 72 42 0 75 3 Mmwyl1_2530 YcgL domain-containing protein Mmwyl1_2530 Marinomonas sp. (strain MWYL1)
B1JCV3 9.34e-17 71 44 0 74 3 PputW619_3899 YcgL domain-containing protein PputW619_3899 Pseudomonas putida (strain W619)
Q2SIW7 2.44e-16 70 43 0 74 3 HCH_02617 YcgL domain-containing protein HCH_02617 Hahella chejuensis (strain KCTC 2396)
Q3J7M5 2.72e-16 75 47 0 71 3 Noc_2718 Putative HAD-like hydrolase Noc_2718 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3KGH4 3.2e-16 70 39 0 87 3 Pfl01_1389 YcgL domain-containing protein Pfl01_1389 Pseudomonas fluorescens (strain Pf0-1)
Q6FA20 6.04e-16 69 38 2 92 3 ACIAD2309 YcgL domain-containing protein ACIAD2309 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1QXJ3 1.07e-15 68 41 0 80 3 Csal_1462 YcgL domain-containing protein Csal_1462 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8GQ48 1.92e-15 68 41 0 75 3 Tgr7_3126 YcgL domain-containing protein Tgr7_3126 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0VNN3 4.48e-15 67 36 0 76 3 ABO_1767 YcgL domain-containing protein ABO_1767 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5WG70 4.12e-14 65 40 1 85 3 PsycPRwf_1721 YcgL domain-containing protein PsycPRwf_1721 Psychrobacter sp. (strain PRwf-1)
Q5H5Q2 1.35e-12 60 36 0 74 3 XOO0464 YcgL domain-containing protein XOO0464 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P8E4 1.35e-12 60 36 0 74 3 XOO0428 YcgL domain-containing protein XOO0428 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SS56 1.35e-12 60 36 0 74 3 PXO_02884 YcgL domain-containing protein PXO_02884 Xanthomonas oryzae pv. oryzae (strain PXO99A)
B0RYM2 4.41e-12 59 36 0 77 3 xcc-b100_4189 YcgL domain-containing protein xcc-b100_4189 Xanthomonas campestris pv. campestris (strain B100)
Q4UP98 4.41e-12 59 36 0 77 3 XC_4086 YcgL domain-containing protein XC_4086 Xanthomonas campestris pv. campestris (strain 8004)
Q8P3S2 9.22e-12 58 41 3 79 3 XCC3997 YcgL domain-containing protein XCC3997 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q3BMW1 4.04e-11 57 33 0 77 3 XCV4171 YcgL domain-containing protein XCV4171 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PF98 5.78e-11 56 33 0 77 3 XAC4085 YcgL domain-containing protein XAC4085 Xanthomonas axonopodis pv. citri (strain 306)
Q1QCL3 1.47e-10 56 36 1 85 3 Pcryo_0807 YcgL domain-containing protein Pcryo_0807 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FTK5 1.53e-10 56 36 1 85 3 Psyc_0800 YcgL domain-containing protein Psyc_0800 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1U124 6.9e-08 49 31 0 73 3 Maqu_1609 YcgL domain-containing protein Maqu_1609 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05650
Feature type CDS
Gene -
Product YcgL domain-containing protein
Location 1231862 - 1232149 (strand: 1)
Length 288 (nucleotides) / 95 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_728
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05166 YcgL domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3100 Function unknown (S) S Uncharacterized conserved protein YcgL, UPF0745 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09902 uncharacterized protein - -

Protein Sequence

MICAIYRSTKRDQTYLYIEKKDDFSRIPEELLQSFGEPQFAMLLDLAQRQRLANADIEKVKQALTDQGFYLQVPPPVESMLNAYLDELKNSEKTE

Flanking regions ( +/- flanking 50bp)

CTAAAATATTCAGGCAAGTCGCTTATTTTAATAATTAGAGTTTAATGAAAATGATTTGTGCAATTTACCGTAGTACCAAGCGTGATCAAACTTATTTATACATCGAAAAAAAAGATGATTTCTCTCGAATTCCTGAGGAATTATTACAAAGTTTTGGTGAACCACAGTTTGCAATGTTGCTAGATCTCGCGCAAAGACAGCGTTTAGCGAATGCAGACATAGAAAAAGTCAAACAAGCGTTGACTGACCAAGGTTTTTATCTACAAGTGCCACCTCCCGTCGAAAGTATGTTAAATGCTTATTTAGATGAATTAAAAAATTCAGAAAAAACTGAATAAATCATCGAGATAAAAGGAGCATAAATGTTCAAATATTCGTTCATCGCGGT