Homologs in group_720

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02205 FBDBKF_02205 79.8 Morganella morganii S1 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
EHELCC_02675 EHELCC_02675 79.8 Morganella morganii S2 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
NLDBIP_00785 NLDBIP_00785 79.8 Morganella morganii S4 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
LHKJJB_01250 LHKJJB_01250 79.8 Morganella morganii S3 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
HKOGLL_01290 HKOGLL_01290 79.8 Morganella morganii S5 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
F4V73_RS04575 F4V73_RS04575 76.3 Morganella psychrotolerans - RidA family protein

Distribution of the homologs in the orthogroup group_720

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_720

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEB9 1.53e-55 171 70 0 114 3 yoaB RutC family protein YoaB Shigella flexneri
P0AEB7 1.53e-55 171 70 0 114 3 yoaB RutC family protein YoaB Escherichia coli (strain K12)
P0AEB8 1.53e-55 171 70 0 114 3 yoaB RutC family protein YoaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P71394 2.06e-30 107 50 2 114 3 HI_1627 RutC family protein HI_1627 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O30825 6.75e-29 103 46 1 113 3 HD_0322 RutC family protein HD_0322 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P37552 2.37e-08 51 28 3 107 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Bacillus subtilis (strain 168)
O52178 6.06e-08 50 33 1 84 3 dfrA Protein DfrA Myxococcus xanthus
Q94JQ4 2.35e-07 50 30 3 110 1 RIDA Reactive Intermediate Deaminase A, chloroplastic Arabidopsis thaliana
Q9UZA3 4.97e-07 48 29 1 84 3 PYRAB12510 RutC family protein PYRAB12510 Pyrococcus abyssi (strain GE5 / Orsay)
P80601 6.01e-07 48 27 2 108 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Capra hircus
Q9KWS2 8.27e-07 47 34 2 76 1 amnD 2-aminomuconate deaminase Pseudomonas sp.
O58584 1.26e-06 47 30 1 84 1 PH0854 RutC family protein PH0854 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P52760 3.42e-06 46 26 3 108 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Mus musculus
Q8U308 4.06e-06 45 30 1 84 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3T114 5.14e-06 45 27 2 108 2 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Bos taurus
B1M5I6 6.32e-06 45 32 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q10121 1.48e-05 45 27 3 107 3 C23G10.2 RutC family protein C23G10.2 Caenorhabditis elegans
P52759 1.71e-05 44 25 3 108 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Rattus norvegicus
P52761 2.97e-05 43 24 3 128 3 slr0709 RutC family protein slr0709 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52758 7.7e-05 42 25 3 108 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Homo sapiens
Q9UR06 0.000126 42 35 2 84 3 mmf2 Protein mmf2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P55654 0.000184 41 24 2 110 3 NGR_a01620 RutC family protein y4sK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q4ZXR9 0.000238 41 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas syringae pv. syringae (strain B728a)
O43003 0.000242 41 29 3 109 3 mmf1 Protein mmf1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
D4GEU6 0.000273 40 28 1 82 3 rutC 3-aminoacrylate deaminase RutC Pantoea ananatis (strain LMG 20103)
D5VGV2 0.000337 40 27 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
A1JMX4 0.000394 40 29 1 82 3 rutC 3-aminoacrylate deaminase RutC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8IAD2 0.000483 40 32 1 80 3 rutC 3-aminoacrylate deaminase RutC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q48MQ6 0.000568 40 29 1 82 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A8GCT4 0.000645 40 26 1 82 3 rutC 3-aminoacrylate deaminase RutC Serratia proteamaculans (strain 568)
B8H1Q2 0.000647 40 27 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A4N4 0.000647 40 27 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q6FFZ5 0.001 39 30 1 80 3 rutC 3-aminoacrylate deaminase RutC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05605
Feature type CDS
Gene -
Product RidA family protein
Location 1222590 - 1222934 (strand: -1)
Length 345 (nucleotides) / 114 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_720
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01042 Endoribonuclease L-PSP

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0251 Defense mechanisms (V) V Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

Protein Sequence

MTIKRIDPEDRWSEAVIYNDTVYYTAVPENLSGDIIEQTADTLAAIDVLLQRVGSDKSKILDATLFLADKADFAGMNQAWDAWVAKGSAPVRCTVQAQLMHPEYKVEIKIIAAL

Flanking regions ( +/- flanking 50bp)

TGGATAGCTAAAAGTACCACCCACGTTGTTAATACAAAGGAGAATTTATCGTGACTATAAAACGTATCGATCCAGAGGACCGTTGGTCTGAAGCGGTTATTTATAATGATACTGTCTATTACACTGCAGTTCCTGAAAACTTATCAGGGGATATAATCGAACAAACTGCAGATACATTAGCAGCTATTGATGTGTTATTACAAAGAGTGGGATCAGATAAAAGTAAGATCCTTGATGCAACACTATTTTTAGCCGATAAAGCCGATTTTGCAGGTATGAATCAAGCATGGGATGCATGGGTTGCTAAAGGGAGCGCGCCAGTACGTTGTACCGTTCAGGCTCAACTCATGCATCCTGAATATAAAGTAGAAATTAAAATCATCGCTGCTCTCTAATTTTTTATTAGCACCCGCACATGCGGGTACTATTTTCTCTTATATGTCGG