Homologs in group_648

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02205 FBDBKF_02205 100.0 Morganella morganii S1 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
EHELCC_02675 EHELCC_02675 100.0 Morganella morganii S2 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
NLDBIP_00785 NLDBIP_00785 100.0 Morganella morganii S4 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
HKOGLL_01290 HKOGLL_01290 100.0 Morganella morganii S5 ridA Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
F4V73_RS04575 F4V73_RS04575 93.9 Morganella psychrotolerans - RidA family protein
PMI_RS05605 PMI_RS05605 79.8 Proteus mirabilis HI4320 - RidA family protein

Distribution of the homologs in the orthogroup group_648

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_648

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEB9 4.75e-52 162 66 0 114 3 yoaB RutC family protein YoaB Shigella flexneri
P0AEB7 4.75e-52 162 66 0 114 3 yoaB RutC family protein YoaB Escherichia coli (strain K12)
P0AEB8 4.75e-52 162 66 0 114 3 yoaB RutC family protein YoaB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P71394 5.03e-31 109 52 2 114 3 HI_1627 RutC family protein HI_1627 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O30825 1.3e-30 108 47 1 113 3 HD_0322 RutC family protein HD_0322 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P37552 2.16e-10 57 32 3 109 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Bacillus subtilis (strain 168)
Q8U308 3.04e-10 56 32 3 112 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O52178 1.04e-09 55 35 1 84 3 dfrA Protein DfrA Myxococcus xanthus
Q9UZA3 1.6e-09 54 29 3 112 3 PYRAB12510 RutC family protein PYRAB12510 Pyrococcus abyssi (strain GE5 / Orsay)
O58584 2.05e-09 54 31 3 112 1 PH0854 RutC family protein PH0854 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q94JQ4 5.92e-09 54 32 3 110 1 RIDA Reactive Intermediate Deaminase A, chloroplastic Arabidopsis thaliana
Q973T6 2.87e-08 51 31 3 113 1 STK_08110 RutC family protein STK_08110 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P52761 4.06e-08 51 25 2 121 3 slr0709 RutC family protein slr0709 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7CP78 5.22e-08 50 34 1 81 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52760 6.17e-08 50 28 2 108 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Mus musculus
P0AF95 8.31e-08 50 32 1 85 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Shigella flexneri
P0AF93 8.31e-08 50 32 1 85 1 ridA 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli (strain K12)
P0AF94 8.31e-08 50 32 1 85 3 yjgF 2-iminobutanoate/2-iminopropanoate deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9L6B5 9.51e-08 50 31 1 86 3 PM1466 RutC family protein PM1466 Pasteurella multocida (strain Pm70)
P80601 1.28e-07 50 28 2 108 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Capra hircus
P52759 1.53e-07 49 26 2 108 1 Rida 2-iminobutanoate/2-iminopropanoate deaminase Rattus norvegicus
Q10121 1.96e-07 50 28 3 107 3 C23G10.2 RutC family protein C23G10.2 Caenorhabditis elegans
Q3T114 3.07e-07 48 28 2 108 2 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Bos taurus
B1M5I6 3.12e-07 48 32 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q9ZKQ6 4.06e-07 48 31 2 108 3 jhp_0879 RutC family protein jhp_0879 Helicobacter pylori (strain J99 / ATCC 700824)
P44839 5.52e-07 48 30 1 86 1 HI_0719 RutC family protein HI_0719 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O25598 7.97e-07 47 30 2 108 3 HP_0944 RutC family protein HP_0944 Helicobacter pylori (strain ATCC 700392 / 26695)
P52758 8.06e-07 47 26 2 108 1 RIDA 2-iminobutanoate/2-iminopropanoate deaminase Homo sapiens
Q6FFZ5 9.6e-07 47 34 1 82 3 rutC 3-aminoacrylate deaminase RutC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5CN81 1.74e-06 47 35 1 82 3 rutC 3-aminoacrylate deaminase RutC Variovorax paradoxus (strain S110)
B7N3G6 2.16e-06 46 28 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7CWX2 2.97e-06 46 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Agrobacterium fabrum (strain C58 / ATCC 33970)
D3QPK3 3.06e-06 46 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O55:H7 (strain CB9615 / EPEC)
Q8XAU5 3.06e-06 46 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O157:H7
D5VGV2 3.42e-06 45 29 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
Q32HQ1 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Shigella dysenteriae serotype 1 (strain Sd197)
Q1RDK7 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain UTI89 / UPEC)
B1LIZ5 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SMS-3-5 / SECEC)
D2NGI7 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O150:H5 (strain SE15)
P0AFQ5 4.38e-06 45 29 2 97 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12)
B1IV87 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AFQ6 4.38e-06 45 29 2 97 1 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ57 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
D5CZH0 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
A1A9R5 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O1:K1 / APEC
A7ZYW5 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O9:H4 (strain HS)
B1X9D1 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / DH10B)
C9QZ66 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD8 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain K12 / MC4100 / BW2952)
C6UFC1 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / REL606)
C6EHJ7 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain B / BL21-DE3)
B7M8Z5 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O8 (strain IAI1)
B7MTF3 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O81 (strain ED1a)
B7NLB6 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MIF7 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O45:K1 (strain S88 / ExPEC)
D3H123 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O44:H18 (strain 042 / EAEC)
B7UNZ3 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKB5 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O139:H28 (strain E24377A / ETEC)
C8U5H2 4.38e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O103:H2 (strain 12009 / EHEC)
A8IAD2 4.96e-06 45 29 3 112 3 rutC 3-aminoacrylate deaminase RutC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q4ZXR9 5.42e-06 45 32 1 82 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas syringae pv. syringae (strain B728a)
Q83LK7 5.93e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri
Q0T624 5.93e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype 5b (strain 8401)
D2AC41 5.93e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Shigella flexneri serotype X (strain 2002017)
B7LFC0 5.99e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain 55989 / EAEC)
C8TNC0 5.99e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM6 5.99e-06 45 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli O111:H- (strain 11128 / EHEC)
O43003 6.6e-06 45 30 4 109 3 mmf1 Protein mmf1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B8H1Q2 7.51e-06 45 29 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A4N4 7.51e-06 45 29 1 84 3 rutC 3-aminoacrylate deaminase RutC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7ME54 9.31e-06 45 29 2 96 3 rutC 3-aminoacrylate deaminase RutC Cronobacter sakazakii (strain ATCC BAA-894)
B6I986 1.07e-05 44 29 2 97 3 rutC 3-aminoacrylate deaminase RutC Escherichia coli (strain SE11)
D3RKL2 1.3e-05 44 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Klebsiella variicola (strain At-22)
A8GCT4 1.3e-05 44 29 1 82 3 rutC 3-aminoacrylate deaminase RutC Serratia proteamaculans (strain 568)
P40185 1.31e-05 44 28 2 107 1 MMF1 Protein MMF1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B5XXN2 1.37e-05 44 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae (strain 342)
Q48MQ6 1.48e-05 44 31 1 82 3 rutC 3-aminoacrylate deaminase RutC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
D4GEU6 1.67e-05 44 30 1 80 3 rutC 3-aminoacrylate deaminase RutC Pantoea ananatis (strain LMG 20103)
Q9V3W0 1.7e-05 44 30 3 112 2 UK114 RutC family protein UK114 Drosophila melanogaster
A6T7A0 1.73e-05 44 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9UR06 2.06e-05 43 35 2 84 3 mmf2 Protein mmf2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C9Y0S5 3.22e-05 43 29 2 96 3 rutC 3-aminoacrylate deaminase RutC Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
P0AGL4 3.28e-05 43 29 1 85 3 tdcF Putative reactive intermediate deaminase TdcF Shigella flexneri
P0AGL2 3.28e-05 43 29 1 85 1 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli (strain K12)
P0AGL3 3.28e-05 43 29 1 85 3 tdcF Putative reactive intermediate deaminase TdcF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1JMX4 5.82e-05 42 30 1 80 3 rutC 3-aminoacrylate deaminase RutC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5B0U7 5.97e-05 42 31 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
A4VQH6 7.61e-05 42 31 1 82 3 rutC 3-aminoacrylate deaminase RutC Stutzerimonas stutzeri (strain A1501)
A9W3H9 7.99e-05 42 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain PA1)
C7CM34 7.99e-05 42 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
B7KWT5 7.99e-05 42 30 1 82 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B1ZB17 8.33e-05 42 31 1 80 3 rutC 3-aminoacrylate deaminase RutC Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
P40431 8.4e-05 42 28 3 107 3 None RutC family protein in vnfA 5'region Azotobacter vinelandii
Q9KWS2 0.000116 42 32 2 80 1 amnD 2-aminomuconate deaminase Pseudomonas sp.
A4W923 0.000175 41 29 3 96 3 rutC 3-aminoacrylate deaminase RutC Enterobacter sp. (strain 638)
D5CE34 0.000204 41 29 1 81 3 rutC 3-aminoacrylate deaminase RutC Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
B9JLT7 0.000333 40 29 1 82 3 rutC 3-aminoacrylate deaminase RutC Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B0SW61 0.000755 39 27 1 81 3 rutC 3-aminoacrylate deaminase RutC Caulobacter sp. (strain K31)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_01250
Feature type CDS
Gene ridA
Product Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
Location 231876 - 232220 (strand: -1)
Length 345 (nucleotides) / 114 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_648
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01042 Endoribonuclease L-PSP

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0251 Defense mechanisms (V) V Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09022 2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10] - -

Protein Sequence

MTIQRIDPEDRWSEAVVHNNTVYYTSVPEDLSGDITAQTTSALHAIDKILARAGSDKSKILDATIFLADKADFAGMNTAWDAWVAKGSAPVRCTVEAALMHPDYKVEIKVIAAV

Flanking regions ( +/- flanking 50bp)

ATAGCACCACCTTGCCGTGTAAGAAACTGGATATATTTACAGGAGAGAGAATGACAATTCAGCGAATTGATCCGGAAGACCGCTGGTCTGAAGCGGTTGTACACAACAACACCGTTTATTACACCAGTGTTCCGGAAGATCTGAGCGGCGATATTACTGCCCAGACCACCAGTGCCCTGCACGCGATCGATAAAATTCTGGCCCGCGCCGGTTCAGATAAAAGCAAAATCCTCGATGCGACCATTTTCCTGGCAGACAAAGCCGATTTTGCCGGTATGAATACCGCCTGGGATGCATGGGTCGCGAAAGGCAGTGCGCCGGTTCGCTGCACCGTGGAAGCTGCTCTGATGCACCCGGATTATAAAGTCGAAATCAAAGTGATCGCGGCTGTCTGAGTGTTGAAAAAGCAGAGATCTCTGTTAATTCAGTGTCTCTGCTGATGACG