Homologs in group_715

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02105 FBDBKF_02105 79.3 Morganella morganii S1 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
EHELCC_02575 EHELCC_02575 79.3 Morganella morganii S2 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
NLDBIP_00885 NLDBIP_00885 79.3 Morganella morganii S4 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
LHKJJB_01150 LHKJJB_01150 79.3 Morganella morganii S3 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
HKOGLL_01190 HKOGLL_01190 79.3 Morganella morganii S5 rpiR DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains
F4V73_RS04470 F4V73_RS04470 77.9 Morganella psychrotolerans - MurR/RpiR family transcriptional regulator

Distribution of the homologs in the orthogroup group_715

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_715

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P46118 1.31e-159 448 74 0 280 3 hexR HTH-type transcriptional regulator HexR Escherichia coli (strain K12)
Q88P32 7.49e-106 311 54 0 277 1 hexR HTH-type transcriptional regulator HexR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O68281 2.42e-100 298 54 0 277 3 hexR HTH-type transcriptional regulator HexR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q143F8 2.84e-52 183 37 0 256 3 glk Bifunctional protein glk Paraburkholderia xenovorans (strain LB400)
Q2SYA5 3.75e-52 183 37 0 256 3 glk Bifunctional protein glk Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63RQ7 3.82e-52 183 37 0 256 3 glk Bifunctional protein glk Burkholderia pseudomallei (strain K96243)
Q62HW8 3.9e-52 183 37 0 256 3 glk Bifunctional protein glk Burkholderia mallei (strain ATCC 23344)
Q3JPP0 4.03e-52 183 37 0 256 3 glk Bifunctional protein glk Burkholderia pseudomallei (strain 1710b)
Q1BYA7 5.01e-51 180 36 0 256 3 glk Bifunctional protein glk Burkholderia orbicola (strain AU 1054)
Q39IQ1 5.67e-51 180 36 0 256 3 glk Bifunctional protein glk Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8RD36 4.52e-43 151 37 2 249 4 TTE0211 Uncharacterized HTH-type transcriptional regulator TTE0211 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P26833 8.97e-31 119 33 4 214 4 CPE0189 Uncharacterized HTH-type transcriptional regulator CPE0189 Clostridium perfringens (strain 13 / Type A)
Q9WYG1 3.82e-30 117 31 4 281 4 TM_0326 Uncharacterized HTH-type transcriptional regulator TM_0326 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q45581 1.07e-29 116 28 2 273 1 ybbH Uncharacterized HTH-type transcriptional regulator YbbH Bacillus subtilis (strain 168)
Q97MK5 1.46e-29 116 29 2 277 4 CA_C0191 Uncharacterized HTH-type transcriptional regulator CA_C0191 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P44540 3.91e-28 112 30 2 254 4 HI_0143 Uncharacterized HTH-type transcriptional regulator HI_0143 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0ACS7 1.08e-16 81 24 1 238 1 rpiR HTH-type transcriptional regulator RpiR Escherichia coli (strain K12)
P0ACS8 1.08e-16 81 24 1 238 3 rpiR HTH-type transcriptional regulator RpiR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P46117 4.4e-16 79 26 7 234 4 None Uncharacterized HTH-type transcriptional regulator in aarA 3'region Providencia stuartii
A8ADG3 6.43e-16 79 25 3 255 3 murR HTH-type transcriptional regulator MurR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YZB5 3.5e-15 77 25 6 268 3 murR HTH-type transcriptional regulator MurR Shigella sonnei (strain Ss046)
B7NPW3 9.01e-15 75 25 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C6UMS6 1.19e-14 75 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / REL606)
C5W7D8 1.19e-14 75 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain B / BL21-DE3)
A9MIE1 3.05e-14 74 24 3 255 3 murR HTH-type transcriptional regulator MurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P37767 3.31e-14 74 27 2 213 4 yfhH Uncharacterized HTH-type transcriptional regulator YfhH Escherichia coli (strain K12)
P77245 4.91e-14 73 25 3 263 1 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12)
B1XA98 4.91e-14 73 25 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / DH10B)
C4ZVV8 4.91e-14 73 25 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain K12 / MC4100 / BW2952)
Q83K75 5.09e-14 73 25 6 268 3 murR HTH-type transcriptional regulator MurR Shigella flexneri
Q32DC7 5.64e-14 73 25 3 263 3 murR HTH-type transcriptional regulator MurR Shigella dysenteriae serotype 1 (strain Sd197)
B7LCH1 7.06e-14 73 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain 55989 / EAEC)
Q0T281 1.31e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Shigella flexneri serotype 5b (strain 8401)
B7LKK8 1.5e-13 72 24 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I503 1.54e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SE11)
B7M6T6 1.54e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O8 (strain IAI1)
A7ZPM7 1.54e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O139:H28 (strain E24377A / ETEC)
A8A2S4 1.71e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O9:H4 (strain HS)
B1LMM1 1.93e-13 72 24 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain SMS-3-5 / SECEC)
C6UQ16 1.96e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5YZX2 1.96e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBJ3 1.96e-13 72 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli O157:H7
B2TX16 2.79e-13 71 25 6 268 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IX45 4.58e-13 71 25 6 268 3 murR HTH-type transcriptional regulator MurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7N617 9.95e-13 70 24 3 263 3 murR HTH-type transcriptional regulator MurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q31Y52 1.49e-12 69 25 6 268 3 murR HTH-type transcriptional regulator MurR Shigella boydii serotype 4 (strain Sb227)
Q9ZD42 3.18e-05 48 26 7 195 3 RP505 Uncharacterized protein RP505 Rickettsia prowazekii (strain Madrid E)
O28478 0.000279 44 24 1 104 1 AF_1796 Uncharacterized protein AF_1796 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05580
Feature type CDS
Gene -
Product MurR/RpiR family transcriptional regulator
Location 1217377 - 1218219 (strand: -1)
Length 843 (nucleotides) / 280 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_715
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01380 SIS domain
PF01418 Helix-turn-helix domain, rpiR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1737 Transcription (K) K DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19337 RpiR family transcriptional regulator, carbohydrate utilization regulator - -

Protein Sequence

MNILERVQSSLDILSKSEKKVAEVVLTTPQTVIHSSIALMAKTADVSEPTVNRFCRRMATKGFPDFKLQLAQSIANGTPYVNRNIDDSDSVSAYTNKIFESAMAGLENVKNNLDIAVINRAVDILTQARKISFFGLGASAAVAHDAMNKFSRFNIPVTYFDDVIMQRMSCINSIDGDVVVIVSHTGRTKNLVEIAKIARENDASVIAITTSGSLLAAEATLPILLDVPEDTDIYMPMISRLAQLTVIDVLATGFILRRGPKFRDNLKRVKEALRDSRFDK

Flanking regions ( +/- flanking 50bp)

TAGATTTCTCCTTTTATTGAAATTGGCAAAGCCAAGGATCTGTATATTTAATGAATATATTGGAAAGGGTTCAGTCTAGTCTGGACATCTTGAGTAAATCAGAAAAAAAAGTGGCTGAGGTTGTTTTAACAACACCACAAACCGTGATCCATTCAAGTATCGCTCTTATGGCGAAAACAGCTGATGTTAGTGAGCCCACTGTAAATCGTTTTTGTCGACGCATGGCAACAAAAGGATTTCCAGATTTTAAGTTACAATTAGCACAAAGCATTGCCAATGGTACACCTTATGTCAATCGTAACATTGATGACTCCGATTCTGTCTCTGCTTATACCAATAAAATATTTGAATCCGCGATGGCGGGTTTAGAGAATGTCAAAAATAATCTCGATATTGCGGTTATTAATCGAGCTGTCGATATTCTTACTCAAGCAAGAAAAATCTCGTTTTTTGGTCTAGGTGCTTCTGCCGCCGTCGCACATGATGCCATGAATAAATTCTCACGTTTCAACATTCCCGTGACCTATTTTGATGATGTTATCATGCAACGAATGAGCTGTATAAATAGTATCGACGGTGATGTTGTGGTGATTGTGTCTCACACAGGTCGTACTAAAAATTTAGTCGAAATTGCTAAAATTGCACGTGAAAATGATGCATCAGTAATAGCGATTACCACTTCTGGCTCTTTATTAGCCGCCGAAGCAACGTTACCCATCTTACTTGATGTACCGGAAGATACCGATATCTACATGCCGATGATTTCTCGCCTTGCACAACTTACCGTTATTGATGTTCTGGCTACAGGGTTTATTTTACGCCGAGGGCCAAAATTTAGAGATAACTTGAAGCGTGTCAAAGAAGCATTACGCGATTCGCGCTTTGATAAGTAACCGTTTTAAATGAATTTGTTAGTATAGTCACATTTAGCAGTGTGCCCTTG