Homologs in group_680

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01905 FBDBKF_01905 96.5 Morganella morganii S1 prs ribose-phosphate diphosphokinase
EHELCC_02375 EHELCC_02375 96.5 Morganella morganii S2 prs ribose-phosphate diphosphokinase
NLDBIP_01085 NLDBIP_01085 96.5 Morganella morganii S4 prs ribose-phosphate diphosphokinase
LHKJJB_00950 LHKJJB_00950 96.5 Morganella morganii S3 prs ribose-phosphate diphosphokinase
HKOGLL_00990 HKOGLL_00990 96.5 Morganella morganii S5 prs ribose-phosphate diphosphokinase
F4V73_RS04250 F4V73_RS04250 95.9 Morganella psychrotolerans prs ribose-phosphate diphosphokinase

Distribution of the homologs in the orthogroup group_680

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_680

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N590 0.0 618 96 0 315 3 prs Ribose-phosphate pyrophosphokinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZEY2 0.0 614 95 0 315 3 prs Ribose-phosphate pyrophosphokinase Yersinia pestis
P0A1V6 0.0 607 94 0 315 1 prs Ribose-phosphate pyrophosphokinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1V7 0.0 607 94 0 315 3 prs Ribose-phosphate pyrophosphokinase Salmonella typhi
P0A717 0.0 607 94 0 315 1 prs Ribose-phosphate pyrophosphokinase Escherichia coli (strain K12)
P0A718 0.0 607 94 0 315 3 prs Ribose-phosphate pyrophosphokinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A719 0.0 607 94 0 315 3 prs Ribose-phosphate pyrophosphokinase Escherichia coli O157:H7
Q9CP22 0.0 570 88 1 314 3 prs Ribose-phosphate pyrophosphokinase Pasteurella multocida (strain Pm70)
Q8K9X2 0.0 570 87 0 315 3 prs Ribose-phosphate pyrophosphokinase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1LTH2 0.0 570 89 0 312 3 prs Ribose-phosphate pyrophosphokinase Baumannia cicadellinicola subsp. Homalodisca coagulata
P57266 0.0 569 87 0 315 3 prs Ribose-phosphate pyrophosphokinase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8EAQ9 0.0 557 84 0 315 3 prs Ribose-phosphate pyrophosphokinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P44328 0.0 557 86 1 314 3 prs Ribose-phosphate pyrophosphokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VL55 0.0 555 86 1 315 3 prs Ribose-phosphate pyrophosphokinase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VR76 0.0 548 83 0 312 3 prs Ribose-phosphate pyrophosphokinase Blochmanniella floridana
P59512 0.0 545 83 0 315 3 prs Ribose-phosphate pyrophosphokinase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7MMZ1 0.0 539 82 0 313 3 prs Ribose-phosphate pyrophosphokinase Vibrio vulnificus (strain YJ016)
Q8DFF5 0.0 539 82 0 313 3 prs Ribose-phosphate pyrophosphokinase Vibrio vulnificus (strain CMCP6)
Q87RN8 0.0 539 82 0 313 3 prs Ribose-phosphate pyrophosphokinase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KQ22 0.0 536 82 0 313 3 prs Ribose-phosphate pyrophosphokinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6W1C7 9.67e-163 458 68 0 313 3 prs Ribose-phosphate pyrophosphokinase Marinomonas sp. (strain MWYL1)
Q888C6 2.25e-158 447 68 1 313 3 prs Ribose-phosphate pyrophosphokinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88PX6 8.21e-158 446 68 1 313 3 prs Ribose-phosphate pyrophosphokinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9HVC5 2.29e-156 442 68 1 313 3 prs Ribose-phosphate pyrophosphokinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NQS9 3.86e-154 437 67 1 312 3 prs Ribose-phosphate pyrophosphokinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P65235 7.12e-154 436 66 1 312 1 prs Ribose-phosphate pyrophosphokinase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65234 7.12e-154 436 66 1 312 3 prs Ribose-phosphate pyrophosphokinase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7VUH1 4.83e-148 421 66 1 308 3 prs Ribose-phosphate pyrophosphokinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W181 4.89e-148 421 66 1 308 3 prs Ribose-phosphate pyrophosphokinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WNY4 4.89e-148 421 66 1 308 3 prs Ribose-phosphate pyrophosphokinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q63XL8 1.96e-145 415 64 1 310 1 prs Ribose-phosphate pyrophosphokinase Burkholderia pseudomallei (strain K96243)
Q8Y2E1 4.53e-145 414 65 1 310 3 prs Ribose-phosphate pyrophosphokinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q82TQ4 8.04e-140 400 61 1 310 3 prs Ribose-phosphate pyrophosphokinase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q83AQ1 2.06e-136 392 59 1 312 3 prs Ribose-phosphate pyrophosphokinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8PNU0 5.52e-135 388 61 1 312 3 prs Ribose-phosphate pyrophosphokinase Xanthomonas axonopodis pv. citri (strain 306)
Q8PC63 9.75e-135 387 60 1 312 3 prs Ribose-phosphate pyrophosphokinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9PA76 1.32e-134 387 59 1 312 3 prs Ribose-phosphate pyrophosphokinase Xylella fastidiosa (strain 9a5c)
Q87A22 3.76e-134 386 59 1 312 3 prs Ribose-phosphate pyrophosphokinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PP15 5.81e-125 362 57 3 313 3 prs Ribose-phosphate pyrophosphokinase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q7M8J0 1.64e-124 361 56 3 313 3 prs Ribose-phosphate pyrophosphokinase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8XHJ4 3.04e-124 361 57 4 315 3 prs Ribose-phosphate pyrophosphokinase Clostridium perfringens (strain 13 / Type A)
Q9ZLA1 8.02e-124 360 55 3 313 3 prs Ribose-phosphate pyrophosphokinase Helicobacter pylori (strain J99 / ATCC 700824)
P56184 3.87e-123 358 54 3 313 3 prs Ribose-phosphate pyrophosphokinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q0C5A1 3.2e-121 353 57 2 313 3 prs Ribose-phosphate pyrophosphokinase Hyphomonas neptunium (strain ATCC 15444)
Q899I8 2.96e-120 351 56 4 314 3 prs Ribose-phosphate pyrophosphokinase Clostridium tetani (strain Massachusetts / E88)
Q8R753 4.01e-119 348 55 4 311 3 prs Ribose-phosphate pyrophosphokinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6AJL7 1.18e-118 347 55 3 314 3 prs Ribose-phosphate pyrophosphokinase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q7VFY9 4.49e-118 345 55 3 313 3 prs Ribose-phosphate pyrophosphokinase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q92N73 4.17e-117 342 54 3 312 3 prs Ribose-phosphate pyrophosphokinase Rhizobium meliloti (strain 1021)
Q98HW3 1.08e-116 342 56 5 314 3 prs Ribose-phosphate pyrophosphokinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8EZN0 2.1e-116 341 52 3 312 3 prs Ribose-phosphate pyrophosphokinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72V73 1.27e-115 339 52 3 312 3 prs Ribose-phosphate pyrophosphokinase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0ARN5 1.19e-114 336 54 3 312 3 prs Ribose-phosphate pyrophosphokinase Maricaulis maris (strain MCS10)
B8GZV1 2.06e-114 336 55 2 313 3 prs Ribose-phosphate pyrophosphokinase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AAV6 2.06e-114 336 55 2 313 3 prs Ribose-phosphate pyrophosphokinase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q89DJ1 1.11e-113 334 53 5 313 3 prs Ribose-phosphate pyrophosphokinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8YIG1 2.24e-113 333 53 3 312 3 prs Ribose-phosphate pyrophosphokinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FZF0 5.08e-113 332 53 3 312 3 prs Ribose-phosphate pyrophosphokinase Brucella suis biovar 1 (strain 1330)
Q97E93 5.59e-112 330 52 4 315 3 prs Ribose-phosphate pyrophosphokinase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8EU34 1.51e-111 329 51 3 311 3 prs Ribose-phosphate pyrophosphokinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8YN97 1.91e-111 329 51 2 310 3 prs Ribose-phosphate pyrophosphokinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q7U7L5 2.99e-111 328 51 3 311 3 prs Ribose-phosphate pyrophosphokinase Parasynechococcus marenigrum (strain WH8102)
Q7VBH4 7.06e-111 327 52 5 313 3 prs Ribose-phosphate pyrophosphokinase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7V6S2 7.32e-111 327 50 3 314 3 prs Ribose-phosphate pyrophosphokinase Prochlorococcus marinus (strain MIT 9313)
P42816 7.4e-111 327 52 3 311 3 prs Ribose-phosphate pyrophosphokinase Bacillus caldolyticus
Q88Z84 1.23e-110 327 51 4 315 3 prs1 Ribose-phosphate pyrophosphokinase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q81J97 1.03e-109 324 52 3 311 3 prs Ribose-phosphate pyrophosphokinase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81VZ0 1.03e-109 324 52 3 311 3 prs Ribose-phosphate pyrophosphokinase Bacillus anthracis
O33924 2.09e-109 323 52 3 311 3 prs Ribose-phosphate pyrophosphokinase Corynebacterium ammoniagenes
Q8UDA9 2.14e-109 323 54 3 312 3 prs Ribose-phosphate pyrophosphokinase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8KCQ2 6.23e-109 322 51 5 312 3 prs Ribose-phosphate pyrophosphokinase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0BPP0 7.35e-109 322 55 3 312 3 prs Ribose-phosphate pyrophosphokinase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P14193 8.15e-109 322 51 3 311 1 prs Ribose-phosphate pyrophosphokinase Bacillus subtilis (strain 168)
Q9CHB8 9.33e-109 322 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q7NM67 1.27e-108 322 50 2 310 3 prs Ribose-phosphate pyrophosphokinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9X1W3 2.7e-108 320 51 4 314 3 prs Ribose-phosphate pyrophosphokinase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q59988 7.11e-108 320 49 4 317 3 prs Ribose-phosphate pyrophosphokinase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q82ZA5 7.99e-108 320 50 4 315 3 prs2 Ribose-phosphate pyrophosphokinase 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q55848 1.27e-107 319 48 2 310 3 prs Ribose-phosphate pyrophosphokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7V111 2e-107 319 49 3 311 3 prs Ribose-phosphate pyrophosphokinase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q42583 5.45e-107 320 48 3 312 2 PRS2 Ribose-phosphate pyrophosphokinase 2, chloroplastic Arabidopsis thaliana
Q8RHM2 1.27e-106 316 49 4 313 3 prs Ribose-phosphate pyrophosphokinase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9KGJ5 2.29e-106 315 52 3 313 3 prs Ribose-phosphate pyrophosphokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0DB99 8.03e-106 314 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P65245 8.03e-106 314 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEL0 8.03e-106 314 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB98 8.03e-106 314 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P65243 8.03e-106 314 52 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pyogenes serotype M1
Q42581 8.88e-106 317 48 3 312 2 PRS1 Ribose-phosphate pyrophosphokinase 1, chloroplastic Arabidopsis thaliana
Q9XG98 1.21e-105 314 47 3 313 2 PRS1 Ribose-phosphate pyrophosphokinase 1 Spinacia oleracea
B9KPJ0 1.89e-105 314 50 4 323 3 prs Ribose-phosphate pyrophosphokinase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B7IFM5 4.74e-105 312 49 4 315 3 prs Ribose-phosphate pyrophosphokinase Thermosipho africanus (strain TCF52B)
Q8DWM2 9.86e-105 311 51 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6Z2L5 3.57e-104 313 48 3 308 2 Os02g0127700 Ribose-phosphate pyrophosphokinase 1, chloroplastic Oryza sativa subsp. japonica
Q69XQ6 1.18e-103 311 48 3 312 2 Os06g0617800 Ribose-phosphate pyrophosphokinase 2, chloroplastic Oryza sativa subsp. japonica
Q9XG99 1.87e-103 311 48 3 313 2 PRS2 Ribose-phosphate pyrophosphokinase 2, chloroplastic Spinacia oleracea
P65240 7.14e-103 307 51 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65239 7.14e-103 307 51 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9CS42 1.39e-102 306 49 3 317 1 Prps2 Ribose-phosphate pyrophosphokinase 2 Mus musculus
Q5R8F8 3.82e-102 305 49 3 317 2 PRPS2 Ribose-phosphate pyrophosphokinase 2 Pongo abelii
Q4R4R7 3.82e-102 305 49 3 317 2 PRPS2 Ribose-phosphate pyrophosphokinase 2 Macaca fascicularis
P11908 3.82e-102 305 49 3 317 1 PRPS2 Ribose-phosphate pyrophosphokinase 2 Homo sapiens
O64888 4.37e-102 307 49 3 307 2 PRS5 Ribose-phosphate pyrophosphokinase 5, chloroplastic Arabidopsis thaliana
Q5XGI0 5.47e-102 305 49 3 317 2 prps2 Ribose-phosphate pyrophosphokinase 2 Xenopus tropicalis
P09330 5.59e-102 304 49 3 317 1 Prps2 Ribose-phosphate pyrophosphokinase 2 Rattus norvegicus
P60892 9.13e-102 304 48 3 317 1 Prps1 Ribose-phosphate pyrophosphokinase 1 Rattus norvegicus
Q5RFJ7 9.13e-102 304 48 3 317 2 PRPS1 Ribose-phosphate pyrophosphokinase 1 Pongo abelii
Q9D7G0 9.13e-102 304 48 3 317 1 Prps1 Ribose-phosphate pyrophosphokinase 1 Mus musculus
P60891 9.13e-102 304 48 3 317 1 PRPS1 Ribose-phosphate pyrophosphokinase 1 Homo sapiens
Q2HJ58 9.13e-102 304 48 3 317 2 PRPS1 Ribose-phosphate pyrophosphokinase 1 Bos taurus
Q4R4U3 4.48e-101 302 48 3 317 2 PRPS1 Ribose-phosphate pyrophosphokinase 1 Macaca fascicularis
Q5ZI49 4.84e-101 302 48 3 323 2 PRPS2 Ribose-phosphate pyrophosphokinase 2 Gallus gallus
Q7ZXC9 5.1e-101 302 48 3 317 2 prps2 Ribose-phosphate pyrophosphokinase 2 Xenopus laevis
Q54PA9 5.95e-101 302 48 3 311 1 prsA Ribose-phosphate pyrophosphokinase A Dictyostelium discoideum
P21108 1.07e-100 301 48 3 317 1 PRPS1L1 Ribose-phosphate pyrophosphokinase 3 Homo sapiens
Q8E2H0 1.32e-100 301 50 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7X8 1.32e-100 301 50 5 316 3 prs1 Ribose-phosphate pyrophosphokinase 1 Streptococcus agalactiae serotype III (strain NEM316)
Q8CQU7 6.22e-99 297 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRQ5 6.22e-99 297 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49V09 1.16e-98 296 50 6 315 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5HIH5 1.97e-98 295 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain COL)
P65238 2.25e-98 295 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain MW2)
Q6GBY8 2.25e-98 295 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain MSSA476)
Q6GJH1 2.25e-98 295 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain MRSA252)
P65237 2.25e-98 295 49 4 314 1 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain N315)
P65236 2.25e-98 295 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
O94413 2.6e-97 293 49 5 314 1 SPCC1620.06c Ribose-phosphate pyrophosphokinase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q48793 4.3e-97 292 48 4 314 3 prs1 Ribose-phosphate pyrophosphokinase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724L4 4.3e-97 292 48 4 314 3 prs1 Ribose-phosphate pyrophosphokinase 1 Listeria monocytogenes serotype 4b (strain F2365)
Q4L3F7 6.64e-97 291 49 4 314 3 prs Ribose-phosphate pyrophosphokinase Staphylococcus haemolyticus (strain JCSC1435)
Q92F68 6.72e-97 291 48 4 314 3 prs1 Ribose-phosphate pyrophosphokinase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q83TK1 3.83e-96 290 47 4 314 3 prs Ribose-phosphate pyrophosphokinase Listeria welshimeri
Q83YI7 9.36e-96 288 48 4 314 3 prs Ribose-phosphate pyrophosphokinase Listeria ivanovii
O67556 1.01e-93 283 46 5 315 3 prs Ribose-phosphate pyrophosphokinase Aquifex aeolicus (strain VF5)
Q7UPM4 5.51e-93 281 46 5 316 3 prs Ribose-phosphate pyrophosphokinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7MT83 1.82e-90 275 45 5 312 3 prs Ribose-phosphate pyrophosphokinase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
P38063 1.16e-89 273 46 5 315 1 PRS4 Ribose-phosphate pyrophosphokinase 4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P38620 1.07e-87 268 45 5 315 1 PRS2 Ribose-phosphate pyrophosphokinase 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q88VA5 5.74e-87 266 46 4 312 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P38689 5.75e-87 266 47 5 319 1 PRS3 Ribose-phosphate pyrophosphokinase 3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q82HE7 1.77e-85 263 44 7 316 3 prs Ribose-phosphate pyrophosphokinase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P75044 3.2e-85 262 43 6 316 3 prs Ribose-phosphate pyrophosphokinase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47304 8.35e-84 258 41 6 317 3 prs Ribose-phosphate pyrophosphokinase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8DZK4 1.42e-83 258 43 6 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E568 1.42e-83 258 43 6 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus agalactiae serotype III (strain NEM316)
Q8FQV2 5e-83 256 43 4 315 3 prs Ribose-phosphate pyrophosphokinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9K3U0 6.02e-83 256 43 6 315 3 prs Ribose-phosphate pyrophosphokinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5XC85 4.47e-82 254 42 5 314 1 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DC01 6.68e-82 253 42 5 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC00 6.68e-82 253 42 5 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8NRU9 9.78e-82 253 42 4 315 3 prs Ribose-phosphate pyrophosphokinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P65242 1.15e-81 253 44 5 315 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P65241 1.15e-81 253 44 5 315 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P46585 2.34e-81 252 44 4 314 3 PRS1 Ribose-phosphate pyrophosphokinase 1 Candida albicans
Q8DU94 3.02e-81 252 40 5 319 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9CEI4 4.79e-81 251 42 6 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q832Z5 5.8e-81 251 41 5 312 3 prs1 Putative ribose-phosphate pyrophosphokinase 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q99ZR0 1.06e-80 250 42 5 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pyogenes serotype M1
Q8P137 1.16e-80 250 42 5 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q723E1 2.62e-80 249 42 6 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Listeria monocytogenes serotype 4b (strain F2365)
Q92EF1 4.96e-80 248 42 5 311 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q54QU9 6.47e-80 248 40 6 314 3 prsC Ribose-phosphate pyrophosphokinase C Dictyostelium discoideum
Q8Y9L8 1.41e-79 247 42 6 314 3 prs2 Putative ribose-phosphate pyrophosphokinase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q98R83 2.88e-78 244 41 3 309 3 prs Ribose-phosphate pyrophosphokinase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8G5P2 9.92e-78 243 41 4 317 3 prs Ribose-phosphate pyrophosphokinase Bifidobacterium longum (strain NCC 2705)
Q75JN8 1.01e-76 240 40 6 325 3 prsB Ribose-phosphate pyrophosphokinase B Dictyostelium discoideum
Q9PQV0 6.78e-76 238 41 6 319 3 prs Ribose-phosphate pyrophosphokinase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P9WKE3 1.01e-75 238 42 4 315 1 prs Ribose-phosphate pyrophosphokinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKE2 1.01e-75 238 42 4 315 3 prs Ribose-phosphate pyrophosphokinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65233 1.01e-75 238 42 4 315 3 prs Ribose-phosphate pyrophosphokinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CD45 1.15e-75 238 42 4 315 3 prs Ribose-phosphate pyrophosphokinase Mycobacterium leprae (strain TN)
P87171 4.88e-75 236 37 6 340 3 SPBC3D6.06c Ribose-phosphate pyrophosphokinase 5 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9RUD2 1.52e-64 209 37 5 313 3 prs Ribose-phosphate pyrophosphokinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9EWS0 2.41e-64 208 38 4 315 3 SCO0782 Putative ribose-phosphate pyrophosphokinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q28DH0 2.13e-58 194 37 7 345 2 prpsap2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Xenopus tropicalis
Q5ZL26 1.81e-57 192 36 7 344 2 PRPSAP2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Gallus gallus
O60256 4.63e-57 191 36 6 344 1 PRPSAP2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Homo sapiens
A2VDS0 1.02e-56 190 36 7 344 2 PRPSAP2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Bos taurus
Q5RBA8 1.14e-56 190 36 6 344 2 PRPSAP2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Pongo abelii
O08618 1.34e-56 190 36 6 344 1 Prpsap2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Rattus norvegicus
Q8R574 1.76e-56 189 36 6 344 1 Prpsap2 Phosphoribosyl pyrophosphate synthase-associated protein 2 Mus musculus
Q08DW2 9.03e-56 187 36 7 344 2 PRPSAP1 Phosphoribosyl pyrophosphate synthase-associated protein 1 Bos taurus
Q14558 2.34e-55 186 36 7 344 1 PRPSAP1 Phosphoribosyl pyrophosphate synthase-associated protein 1 Homo sapiens
Q9D0M1 2.49e-55 186 36 7 344 1 Prpsap1 Phosphoribosyl pyrophosphate synthase-associated protein 1 Mus musculus
Q63468 4.35e-55 186 36 7 344 1 Prpsap1 Phosphoribosyl pyrophosphate synthase-associated protein 1 Rattus norvegicus
P41831 3.58e-46 164 42 3 202 3 SPAC4A8.14 Ribose-phosphate pyrophosphokinase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P41831 2.62e-13 73 36 3 115 3 SPAC4A8.14 Ribose-phosphate pyrophosphokinase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q58761 1.32e-43 154 33 6 272 1 prs Ribose-phosphate pyrophosphokinase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TUT6 1.84e-41 148 30 6 303 3 prs Ribose-phosphate pyrophosphokinase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
O59586 5.53e-41 147 33 6 245 3 prs Ribose-phosphate pyrophosphokinase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P32895 1.29e-40 149 41 3 206 1 PRS1 Ribose-phosphate pyrophosphokinase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P32895 5.36e-17 84 41 3 115 1 PRS1 Ribose-phosphate pyrophosphokinase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O26877 5.48e-40 144 34 4 266 3 prs Ribose-phosphate pyrophosphokinase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8U458 2.22e-39 142 34 6 245 3 prs Ribose-phosphate pyrophosphokinase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A5UNK4 8.05e-39 142 31 5 270 3 prs Ribose-phosphate pyrophosphokinase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q973F3 2.6e-38 140 28 5 280 3 prs Ribose-phosphate pyrophosphokinase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O52958 3.8e-38 139 32 7 249 1 prs Ribose-phosphate pyrophosphokinase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q4J9A6 1.74e-37 138 29 5 276 3 prs Ribose-phosphate pyrophosphokinase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9UY08 3.16e-37 137 30 7 268 3 prs Ribose-phosphate pyrophosphokinase Pyrococcus abyssi (strain GE5 / Orsay)
Q8TRK8 2.5e-35 132 31 8 303 3 prs Ribose-phosphate pyrophosphokinase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PUX3 1.36e-34 130 31 8 300 3 prs Ribose-phosphate pyrophosphokinase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9HLV6 3.23e-34 129 29 6 272 3 prs Ribose-phosphate pyrophosphokinase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q97CA5 2.11e-33 127 30 7 276 1 prs Ribose-phosphate pyrophosphokinase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q8ZU24 1.22e-32 125 35 7 244 3 prs Ribose-phosphate pyrophosphokinase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q97Z86 2.73e-32 124 27 5 276 1 prs Ribose-phosphate pyrophosphokinase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9YAW0 2.08e-31 122 29 3 270 3 prs Ribose-phosphate pyrophosphokinase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
O28853 3.19e-30 118 31 8 272 3 prs2 Ribose-phosphate pyrophosphokinase 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O29666 1.62e-28 114 30 6 300 3 prs1 Ribose-phosphate pyrophosphokinase 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9HN88 3.02e-28 113 33 5 249 3 prs Ribose-phosphate pyrophosphokinase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7B4 3.02e-28 113 33 5 249 3 prs Ribose-phosphate pyrophosphokinase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q12265 2.55e-24 105 44 1 115 1 PRS5 Ribose-phosphate pyrophosphokinase 5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q12265 8.61e-20 92 38 1 111 1 PRS5 Ribose-phosphate pyrophosphokinase 5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q12265 1.38e-12 71 43 3 88 1 PRS5 Ribose-phosphate pyrophosphokinase 5 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8S2E5 7.8e-17 84 27 11 286 2 Os01g0723600 Ribose-phosphate pyrophosphokinase 3, chloroplastic Oryza sativa subsp. japonica
Q9XGA0 3.54e-16 82 26 11 315 2 PRS3 Ribose-phosphate pyrophosphokinase 3, mitochondrial Spinacia oleracea
Q9XGA1 2.59e-15 78 27 12 315 2 PRS4 Ribose-phosphate pyrophosphokinase 4 Spinacia oleracea
Q93Z66 2.11e-14 76 26 13 317 2 PRS3 Ribose-phosphate pyrophosphokinase 3, chloroplastic Arabidopsis thaliana
Q680A5 2.18e-14 76 27 14 318 1 PRS4 Ribose-phosphate pyrophosphokinase 4 Arabidopsis thaliana
Q6ZFT5 5.82e-13 72 26 11 319 2 Os02g0714600 Ribose-phosphate pyrophosphokinase 4 Oryza sativa subsp. japonica
B7GNR5 8.07e-06 49 31 2 115 3 upp Uracil phosphoribosyltransferase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B3DPH5 1.02e-05 49 37 1 82 3 upp Uracil phosphoribosyltransferase Bifidobacterium longum (strain DJO10A)
B8DVI9 1.35e-05 48 35 1 82 3 upp Uracil phosphoribosyltransferase Bifidobacterium animalis subsp. lactis (strain AD011)
A0ZZM2 4.29e-05 47 27 2 115 3 upp Uracil phosphoribosyltransferase Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B0K1G2 0.000625 43 54 0 35 3 upp Uracil phosphoribosyltransferase Thermoanaerobacter sp. (strain X514)
B0K7G1 0.000625 43 54 0 35 3 upp Uracil phosphoribosyltransferase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A0B5B7 0.000786 43 36 3 93 3 Mthe_0089 PyrE-like protein Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05245
Feature type CDS
Gene prs
Product ribose-phosphate diphosphokinase
Location 1146469 - 1147416 (strand: -1)
Length 948 (nucleotides) / 315 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_680
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13793 N-terminal domain of ribose phosphate pyrophosphokinase
PF14572 Phosphoribosyl synthetase-associated domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0462 Nucleotide transport and metabolism (F) F Phosphoribosylpyrophosphate synthetase

Kegg Ortholog Annotation(s)

Protein Sequence

MPDMKLFAGNATPELAQRVANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDVFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRVLTCDLHAEQIQGFFDVPVDNVFGSPILLEDMLQKELDNPIVVSPDIGGVVRARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVANRDCILVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAVENIRSSVIDEVVVCDTIPLSAEIKALNKVRSLTLSGMLAEAIRRISNEESISAMFEH

Flanking regions ( +/- flanking 50bp)

TTTACAGGTCAACAATATCTCTCTCTGGACGCAAGCCTGAGGTTTTTCTCGTGCCCGATATGAAGCTTTTTGCTGGTAACGCAACCCCGGAACTGGCTCAACGTGTTGCCAATCGACTCTATACTAGCTTAGGAGACGCTGCTGTAGGTCGTTTTAGCGACGGTGAAGTCAGTGTGCAAATCAACGAAAACGTACGTGGTGGTGATGTTTTTATCATTCAATCAACCTGCGCACCAACTAATGATAACTTAATGGAATTAGTGGTCATGGTTGATGCATTACGTCGAGCTTCCGCTGGTCGTATCACTGCTGTTATTCCTTACTTCGGCTATGCCCGTCAGGATCGCCGTGTTCGTTCAGCCCGTGTTCCTATCACGGCTAAAGTTGTTGCGGATTTCTTATCTAGTGTAGGCGTAGACCGTGTTTTAACCTGCGACTTACATGCAGAACAAATCCAAGGGTTCTTTGATGTACCGGTTGACAATGTCTTCGGCAGCCCGATCCTTTTAGAAGATATGCTTCAAAAAGAATTGGACAACCCTATTGTTGTTTCTCCAGATATTGGCGGTGTTGTTCGCGCTCGTGCTATCGCTAAACTTCTGAATGATACTGATATGGCAATTATTGATAAACGTCGCCCTCGTGCTAACGTTTCTCAAGTTATGCATATTATCGGTGACGTTGCTAATCGCGACTGTATCCTTGTTGACGATATGATCGATACAGGTGGTACATTATGTAAAGCAGCAGAAGCGCTGAAAGAACGTGGTGCTAAACGTGTATTTGCTTACGCGACTCACCCTATTTTCTCTGGTAATGCTGTTGAGAACATCAGAAGCTCTGTTATTGATGAAGTGGTTGTCTGCGATACAATTCCATTGTCAGCAGAAATCAAAGCATTAAATAAAGTCCGCTCATTGACCTTGTCTGGTATGTTGGCTGAAGCCATTCGTCGTATCAGTAATGAAGAGTCAATTTCTGCGATGTTCGAACATTAATTTGTCGATTTAATATCGTACTTTGAGATAATTAAACCCGCTATAGCCTA