Homologs in group_8

Help

20 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04395 FBDBKF_04395 30.0 Morganella morganii S1 ilvI acetolactate synthase 3 large subunit
FBDBKF_08160 FBDBKF_08160 29.6 Morganella morganii S1 ilvG acetolactate synthase 2 catalytic subunit
FBDBKF_17020 FBDBKF_17020 33.1 Morganella morganii S1 ilvB acetolactate synthase large subunit
EHELCC_05685 EHELCC_05685 30.0 Morganella morganii S2 ilvI acetolactate synthase 3 large subunit
EHELCC_13370 EHELCC_13370 29.6 Morganella morganii S2 ilvG acetolactate synthase 2 catalytic subunit
EHELCC_16570 EHELCC_16570 33.1 Morganella morganii S2 ilvB acetolactate synthase large subunit
NLDBIP_06005 NLDBIP_06005 30.0 Morganella morganii S4 ilvI acetolactate synthase 3 large subunit
NLDBIP_13705 NLDBIP_13705 29.6 Morganella morganii S4 ilvG acetolactate synthase 2 catalytic subunit
NLDBIP_16780 NLDBIP_16780 33.1 Morganella morganii S4 ilvB acetolactate synthase large subunit
LHKJJB_02885 LHKJJB_02885 30.0 Morganella morganii S3 ilvI acetolactate synthase 3 large subunit
LHKJJB_12850 LHKJJB_12850 29.6 Morganella morganii S3 ilvG acetolactate synthase 2 catalytic subunit
LHKJJB_16690 LHKJJB_16690 33.1 Morganella morganii S3 ilvB acetolactate synthase large subunit
HKOGLL_06360 HKOGLL_06360 30.0 Morganella morganii S5 ilvI acetolactate synthase 3 large subunit
HKOGLL_12180 HKOGLL_12180 29.6 Morganella morganii S5 ilvG acetolactate synthase 2 catalytic subunit
HKOGLL_17655 HKOGLL_17655 33.1 Morganella morganii S5 ilvB acetolactate synthase large subunit
F4V73_RS08840 F4V73_RS08840 29.1 Morganella psychrotolerans ilvI acetolactate synthase 3 large subunit
F4V73_RS18480 F4V73_RS18480 32.9 Morganella psychrotolerans ilvB acetolactate synthase large subunit
F4V73_RS18690 F4V73_RS18690 29.8 Morganella psychrotolerans ilvG acetolactate synthase 2 catalytic subunit
PMI_RS16400 PMI_RS16400 29.5 Proteus mirabilis HI4320 ilvG acetolactate synthase 2 catalytic subunit
PMI_RS17490 PMI_RS17490 31.6 Proteus mirabilis HI4320 ilvB acetolactate synthase large subunit

Distribution of the homologs in the orthogroup group_8

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_8

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27696 0.0 689 60 1 556 1 budB Acetolactate synthase, catabolic Klebsiella pneumoniae
Q04524 0.0 662 58 1 558 3 budB Acetolactate synthase, catabolic Raoultella terrigena
Q04789 1.33e-179 521 48 3 552 2 alsS Acetolactate synthase Bacillus subtilis (strain 168)
O08353 1.23e-72 246 31 7 551 3 ilvB Probable acetolactate synthase large subunit Methanococcus aeolicus
Q57725 1.83e-68 234 30 12 554 3 ilvB Probable acetolactate synthase large subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P00893 8.34e-58 206 28 14 540 1 ilvI Acetolactate synthase isozyme 3 large subunit Escherichia coli (strain K12)
O78518 1.89e-57 204 27 9 553 3 ilvB Acetolactate synthase large subunit Guillardia theta
P40811 2.42e-57 204 28 11 535 3 ilvI Acetolactate synthase isozyme 3 large subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DP90 3.44e-57 203 28 11 546 1 ilvG Acetolactate synthase isozyme 2 large subunit Escherichia coli (strain K12)
P08142 7.45e-57 202 28 11 550 1 ilvB Acetolactate synthase isozyme 1 large subunit Escherichia coli (strain K12)
Q89AP7 1.59e-55 199 29 12 525 3 ilvI Acetolactate synthase large subunit Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1XDF6 1.38e-54 197 28 12 555 3 ilvB Acetolactate synthase large subunit Neopyropia yezoensis
P96591 1.44e-54 197 29 11 528 2 ydaP Putative thiamine pyrophosphate-containing protein YdaP Bacillus subtilis (strain 168)
P37251 2.74e-54 196 27 10 527 1 ilvB Acetolactate synthase large subunit Bacillus subtilis (strain 168)
Q9RQ65 5.7e-54 195 27 11 543 3 ilvI Acetolactate synthase large subunit Buchnera aphidicola subsp. Schlechtendalia chinensis
P69684 9.47e-53 192 28 12 545 3 ilvB Acetolactate synthase large subunit Porphyra umbilicalis
P69683 9.47e-53 192 28 12 545 3 ilvB Acetolactate synthase large subunit Porphyra purpurea
O19929 2.4e-52 191 28 11 556 3 ilvB Acetolactate synthase large subunit Cyanidium caldarium
O33112 1.94e-51 189 28 12 544 3 ilvB Acetolactate synthase Mycobacterium leprae (strain TN)
P27868 2.17e-51 188 27 15 571 3 ilvY Acetolactate synthase (Fragment) Arthrospira platensis
P57321 3.19e-51 187 26 9 538 3 ilvI Acetolactate synthase large subunit Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O85293 5.02e-51 187 26 9 531 3 ilvI Acetolactate synthase large subunit Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0A623 3.76e-50 186 28 13 550 3 ilvB Acetolactate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WG41 3.76e-50 186 28 13 550 1 ilvB1 Acetolactate synthase large subunit IlvB1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG40 3.76e-50 186 28 13 550 3 ilvB1 Acetolactate synthase large subunit IlvB1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P45261 4.5e-50 184 26 10 544 3 ilvI Acetolactate synthase large subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P09342 3.24e-48 181 26 12 564 1 ALS Acetolactate synthase 1, chloroplastic Nicotiana tabacum SURA
P42463 3.68e-48 180 28 12 552 3 ilvB Acetolactate synthase large subunit Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P09114 2.1e-47 179 26 12 563 1 ALS Acetolactate synthase 2, chloroplastic Nicotiana tabacum SURB
Q59498 4.37e-47 177 28 14 550 3 ilvB Acetolactate synthase Mycobacterium avium
Q6NV04 4.48e-46 174 26 15 578 2 ilvbl 2-hydroxyacyl-CoA lyase 2 Danio rerio
P27818 1.32e-45 173 26 14 560 3 None Acetolactate synthase 1, chloroplastic Brassica napus
P27819 1.89e-45 173 26 14 560 3 None Acetolactate synthase 3, chloroplastic Brassica napus
P17597 2.66e-45 172 26 14 564 1 ALS Acetolactate synthase, chloroplastic Arabidopsis thaliana
P36620 3.05e-45 172 26 13 572 3 ilv1 Acetolactate synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A2I2F2I5 4.71e-45 172 25 13 573 3 cfoL Acetolactate synthase catalytic subunit, mitochondrial Aspergillus candidus
Q02137 7.51e-45 170 27 9 543 3 ilvB Acetolactate synthase large subunit Lactococcus lactis subsp. lactis (strain IL1403)
P0AEP7 8.89e-45 170 26 12 485 1 gcl Glyoxylate carboligase Escherichia coli (strain K12)
P0AEP8 8.89e-45 170 26 12 485 3 gcl Glyoxylate carboligase Escherichia coli O157:H7
A6QQT9 1.26e-44 170 25 15 593 2 ILVBL 2-hydroxyacyl-CoA lyase 2 Bos taurus
Q9LCV9 9.6e-44 167 26 13 523 1 ceaS N(2)-(2-carboxyethyl)arginine synthase Streptomyces clavuligerus
Q6SSJ3 1.05e-43 169 25 12 570 3 ILV2 Acetolactate synthase, mitochondrial Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q93PS3 1.97e-43 166 26 15 564 1 xsc Sulfoacetaldehyde acetyltransferase Desulfonispora thiosulfatigenes
Q8BU33 8.85e-43 165 25 16 590 1 Ilvbl 2-hydroxyacyl-CoA lyase 2 Mus musculus
Q6K2E8 1.04e-42 165 25 11 562 2 ALS1 Acetolactate synthase 1, chloroplastic Oryza sativa subsp. japonica
Q5KPJ5 1.15e-42 166 25 12 570 3 ILV2 Acetolactate synthase, mitochondrial Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q41768 2.18e-42 164 25 13 562 3 ALS1 Acetolactate synthase 1, chloroplastic Zea mays
Q9LF46 4.1e-42 162 25 13 555 1 HACL 2-hydroxyacyl-CoA lyase Arabidopsis thaliana
Q9UJ83 4.53e-42 162 25 13 562 1 HACL1 2-hydroxyacyl-CoA lyase 1 Homo sapiens
P14874 2.27e-41 161 24 11 567 3 None Acetolactate synthase 2, chloroplastic Brassica napus
P0DUV9 1.02e-40 159 26 18 559 1 None 2-hydroxyacyl-CoA lyase Actinomycetospora chiangmaiensis (strain DSM 45062 / JCM 15998 / CCTCC AA 205017 / NBRC 104400 / YIM 0006)
P07342 1.65e-40 159 24 11 570 1 ILV2 Acetolactate synthase catalytic subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P37063 2.23e-40 158 24 10 534 1 pox5 Pyruvate oxidase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A1L0T0 7.52e-40 157 24 17 589 1 ILVBL 2-hydroxyacyl-CoA lyase 2 Homo sapiens
Q41769 7.81e-40 157 26 11 561 3 ALS2 Acetolactate synthase 2, chloroplastic Zea mays
Q8CHM7 9.81e-40 155 24 12 563 1 Hacl1 2-hydroxyacyl-CoA lyase 1 Rattus norvegicus
P9WG39 9.56e-39 152 24 8 540 1 ilvG Acetolactate synthase large subunit IlvG Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG38 9.56e-39 152 24 8 540 3 ilvG Acetolactate synthase large subunit IlvG Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66947 9.56e-39 152 24 8 540 3 ilvG Probable acetolactate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O06335 2.45e-38 151 24 16 559 2 ilvB2 Putative acetolactate synthase large subunit IlvB2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7U5G1 2.66e-38 152 25 10 555 3 ilvB Acetolactate synthase large subunit Parasynechococcus marenigrum (strain WH8102)
Q9QXE0 1.02e-37 150 24 12 561 1 Hacl1 2-hydroxyacyl-CoA lyase 1 Mus musculus
Q7XKQ8 2.46e-37 150 24 11 561 2 ALS2 Probable acetolactate synthase 2, chloroplastic Oryza sativa subsp. japonica
Q84H41 2e-36 146 25 11 550 1 xsc Sulfoacetaldehyde acetyltransferase Alcaligenes xylosoxydans xylosoxydans
P07003 2.76e-36 145 25 9 544 1 poxB Pyruvate dehydrogenase [ubiquinone] Escherichia coli (strain K12)
P0CH62 4.79e-36 145 23 8 554 1 None Cyclohexane-1,2-dione hydrolase Azoarcus sp.
P0DP89 4.27e-35 137 31 4 326 5 ilvG Putative acetolactate synthase isozyme 2 large subunit Escherichia coli (strain K12)
Q84H44 1.04e-34 141 25 14 551 1 xsc Sulfoacetaldehyde acetyltransferase Castellaniella defragrans
P39994 8.15e-34 138 25 12 529 1 PXP1 2-hydroxyacyl-CoA lyase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9HUI8 9.05e-34 138 26 12 530 1 aruI Probable 2-ketoarginine decarboxylase AruI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0JMH0 2.44e-33 137 24 13 543 3 Os01g0505400 2-hydroxyacyl-CoA lyase Oryza sativa subsp. japonica
Q6DDK5 1.79e-32 135 25 13 544 2 ilvbl 2-hydroxyacyl-CoA lyase 2 Xenopus laevis
P51853 5.38e-32 133 25 12 552 1 bznB Benzaldehyde lyase Pseudomonas fluorescens
O61856 2.3e-31 132 23 13 584 3 T26C12.1 2-hydroxyacyl-CoA lyase 2 Caenorhabditis elegans
P0AFI0 1.25e-27 120 23 12 552 1 oxc Oxalyl-CoA decarboxylase Escherichia coli (strain K12)
P0AFI1 1.25e-27 120 23 12 552 3 oxc Oxalyl-CoA decarboxylase Escherichia coli O157:H7
Q9Y7M1 1.31e-27 120 25 15 575 3 hac1 2-hydroxyacyl-CoA lyase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q92UW6 1.97e-27 120 25 15 544 3 xsc Probable sulfoacetaldehyde acetyltransferase Rhizobium meliloti (strain 1021)
Q54DA9 4.82e-26 115 21 15 589 3 hacl1 2-hydroxyacyl-CoA lyase 1 Dictyostelium discoideum
P40149 9.07e-26 114 22 11 557 1 oxc Oxalyl-CoA decarboxylase Oxalobacter formigenes
Q54970 2.06e-25 114 22 13 532 3 spxB Pyruvate oxidase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q0TUZ2 2.32e-25 114 23 14 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XP76 3.99e-25 113 23 16 529 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Clostridium perfringens (strain 13 / Type A)
A3SR25 1.98e-24 110 24 16 556 1 xsc Sulfoacetaldehyde acetyltransferase Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM)
D5AKX8 1.76e-23 108 22 15 559 2 xsc Sulfoacetaldehyde acetyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q58077 4.4e-22 103 22 16 534 3 MJ0663 Uncharacterized protein MJ0663 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A4IPB6 4.81e-21 100 23 16 537 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Geobacillus thermodenitrificans (strain NG80-2)
P51852 3.58e-20 97 24 21 557 1 ipdC Indole-3-pyruvate decarboxylase Azospirillum brasilense
Q4V1F5 1.27e-19 96 22 16 530 3 iolD2 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 2 Bacillus cereus (strain ZK / E33L)
Q81QB5 3.34e-19 95 22 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus anthracis
C3LHY1 3.34e-19 95 22 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAZ3 3.34e-19 95 22 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus anthracis (strain A0248)
B7JPM3 3.4e-19 95 22 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus cereus (strain AH820)
Q6HIK2 3.55e-19 94 22 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63B73 8.23e-19 93 22 16 527 3 iolD1 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 1 Bacillus cereus (strain ZK / E33L)
Q5KYR0 2.08e-18 92 20 12 529 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Geobacillus kaustophilus (strain HTA426)
B2V4K0 2.48e-18 92 22 18 567 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Clostridium botulinum (strain Alaska E43 / Type E3)
C1EVJ3 2.06e-17 89 21 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus cereus (strain 03BB102)
A0REB6 2.06e-17 89 21 17 528 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus thuringiensis (strain Al Hakam)
B2TJ86 4.05e-17 88 21 18 567 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Clostridium botulinum (strain Eklund 17B / Type B)
Q9P7P6 4.92e-17 87 22 19 573 3 SPAC186.09 Probable pyruvate decarboxylase C186.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5WKY8 1.46e-15 83 20 14 517 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Shouchella clausii (strain KSM-K16)
Q898E8 8.51e-15 81 21 16 524 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Clostridium tetani (strain Massachusetts / E88)
A5YBJ6 8.79e-15 80 21 11 482 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Lacticaseibacillus casei
O05031 1.62e-14 77 40 0 99 5 HI_0737 Putative uncharacterized protein HI_0737 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2UKV4 1.5e-13 77 22 18 541 3 pdcA Pyruvate decarboxylase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P42415 2.51e-13 76 20 12 509 1 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus subtilis (strain 168)
Q9KAG9 1.26e-12 74 20 11 511 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q12629 2.22e-12 73 23 18 485 1 PDC1 Pyruvate decarboxylase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q65D03 2.47e-12 73 19 14 515 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P34734 9.94e-12 71 22 21 527 3 PDC Pyruvate decarboxylase Hanseniaspora uvarum
P20906 1.27e-10 67 20 17 540 1 mdlC Benzoylformate decarboxylase Pseudomonas putida
Q0CNV1 3.65e-10 66 21 16 540 3 pdcA Pyruvate decarboxylase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P10343 4.4e-10 65 24 9 366 4 None Uncharacterized 42.6 kDa protein in isoamylase 3'region Pseudomonas amyloderamosa
Q9HUR2 6.88e-10 65 20 17 546 3 mdlC Benzoylformate decarboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q92345 9.28e-10 65 21 27 570 1 SPAC1F8.07c Probable pyruvate decarboxylase C1F8.07c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P33149 1.29e-09 64 23 20 485 3 PDC1 Pyruvate decarboxylase Kluyveromyces marxianus
Q6FJA3 1.95e-09 63 21 20 535 1 PDC1 Pyruvate decarboxylase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q92EQ4 2.57e-09 63 21 14 501 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P16467 2.98e-09 63 23 12 337 1 PDC5 Pyruvate decarboxylase isozyme 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A7ZAH8 3.42e-09 63 20 12 509 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P87208 7.88e-09 62 20 15 538 3 pdcA Pyruvate decarboxylase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P06169 1.54e-08 61 21 17 479 1 PDC1 Pyruvate decarboxylase isozyme 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P83779 1.91e-08 60 21 17 490 1 PDC11 Pyruvate decarboxylase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q09737 4.16e-08 59 22 11 348 3 SPAC13A11.06 Putative pyruvate decarboxylase C13A11.06 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O42873 5.88e-08 59 26 11 287 3 SPAC3G9.11c Putative pyruvate decarboxylase C3G9.11c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8Y9Y1 6.63e-08 59 20 13 494 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P33287 7.43e-08 58 20 20 566 1 cfp Pyruvate decarboxylase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P26263 1.06e-07 58 24 12 287 1 PDC6 Pyruvate decarboxylase isozyme 3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q723S8 2.02e-07 57 21 14 496 3 iolD 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase Listeria monocytogenes serotype 4b (strain F2365)
P23234 7.22e-06 52 21 16 493 1 ipdC Indole-3-pyruvate decarboxylase Enterobacter cloacae
P51844 1.19e-05 52 21 22 545 3 pdcA Pyruvate decarboxylase Aspergillus parasiticus
Q8CZD8 2.3e-05 50 26 4 162 3 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q838J9 0.00014 48 25 12 298 3 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
P28516 0.000228 47 21 23 511 2 PDC1 Pyruvate decarboxylase 1 Zea mays
Q06408 0.000288 47 21 30 560 1 ARO10 Transaminated amino acid decarboxylase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P51850 0.000417 47 21 21 502 2 PDC1 Pyruvate decarboxylase 1 Pisum sativum
Q9CBD6 0.000439 47 26 10 218 3 kdc Alpha-keto-acid decarboxylase Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05145
Feature type CDS
Gene alsS
Product acetolactate synthase AlsS
Location 1123899 - 1125578 (strand: -1)
Length 1680 (nucleotides) / 559 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_8
Orthogroup size 21
N. genomes 7

Actions

Genomic region

Domains

PF00205 Thiamine pyrophosphate enzyme, central domain
PF02775 Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
PF02776 Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0028 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH Acetolactate synthase large subunit or other thiamine pyrophosphate-requiring enzyme

Protein Sequence

MNSHHWNCGADLVVKQLEQHGVKQVFGIPGAKIDRVFDSLVDSTIKTIVVRHEANAAFMAGAVGRLTGKAGVAIATSGPGCSNLATGIATATSEGDPLVALGGSVKSTDRLKLVHQSMDTVTMFNPITKFCAEVDSSQSISETLANAFRHAESGRPGSAFLTFPMDILNNEVDSPLLTPKSKPNLGAASDSAIQEAISLLLQAKNPVILIGLQASDPENALALQNFLDIFPVPIVGTYQSAGAIAHRHFPLFAGRIGLFNNQPGDELLAHADLVITLGYSPIEYEPSLWNSHNANIIHIDEIQAEIDLAYCPALELTGNIKLTLDKLTQQLTHQPNSKLQLSNQSQGILEKIRQQREILQQNSYFRQGTPIHPLTIIHEMQDIIDNDVTLCIDMGSFHIWLARYLYSFRARQMLISNGQQTMGVALPWGIGASFVRPCDKIISVSGDGGFMQSSMELETAVRLNTNILHIIWVDNAYNMVEMQEEVKYGRPSGVKFGPIDFKRYAESFGAKGFSVECASQLRETLRKAIAVDGPAVLAIPVDYRDNDKLMKHINYNLII

Flanking regions ( +/- flanking 50bp)

AAAGGTCATTCTGTTTTTATTCATTCACTTGCAAACTTAAAGAAGGTTTTATGAACTCTCATCATTGGAATTGCGGTGCTGACTTGGTGGTTAAGCAATTAGAACAACATGGTGTTAAACAAGTTTTTGGGATCCCCGGAGCCAAAATTGACCGTGTTTTTGATTCTTTGGTTGATTCAACAATTAAAACTATTGTTGTGCGTCACGAAGCCAATGCGGCTTTTATGGCGGGTGCGGTAGGACGTTTAACCGGTAAAGCGGGTGTGGCGATAGCCACTTCTGGTCCCGGTTGTTCTAATCTAGCAACGGGCATTGCGACAGCTACATCAGAAGGTGATCCTCTAGTTGCCTTAGGAGGCTCAGTTAAATCTACGGATAGACTTAAACTGGTTCATCAAAGTATGGACACAGTAACAATGTTTAACCCAATCACTAAGTTTTGTGCTGAAGTTGATTCTTCACAATCAATTTCAGAGACGTTAGCCAATGCTTTTCGTCATGCGGAGTCAGGTCGTCCCGGCTCGGCTTTTTTAACCTTTCCAATGGATATACTCAATAATGAGGTAGATAGCCCGTTATTAACACCTAAATCCAAACCTAATTTAGGTGCCGCGAGTGATAGTGCAATTCAAGAAGCGATCAGCTTATTATTACAAGCGAAAAACCCTGTGATATTAATAGGGCTTCAAGCCAGCGATCCGGAAAATGCTCTTGCCTTACAAAATTTCCTTGATATTTTTCCTGTTCCTATTGTAGGTACTTATCAATCTGCCGGGGCTATTGCTCATCGCCATTTTCCACTCTTTGCCGGACGAATTGGCTTATTTAATAATCAGCCAGGGGATGAATTACTGGCACACGCTGATTTAGTTATCACTTTAGGTTATAGCCCGATTGAGTATGAGCCTTCCTTATGGAACAGTCATAATGCCAATATTATCCATATTGATGAGATCCAAGCTGAAATCGATTTAGCTTACTGCCCTGCCTTAGAATTAACAGGCAATATTAAATTAACACTGGATAAGTTAACGCAACAATTAACTCACCAGCCTAATTCAAAATTACAATTGTCTAATCAGAGCCAAGGAATACTAGAGAAAATACGTCAGCAAAGGGAAATTTTGCAACAAAATAGTTATTTTAGACAAGGCACACCTATTCATCCTTTAACTATCATACATGAAATGCAAGATATCATTGATAACGATGTCACTCTTTGTATTGATATGGGGAGTTTTCATATTTGGCTTGCACGTTACCTTTATAGTTTTAGAGCGAGACAAATGCTAATTTCTAATGGCCAACAAACCATGGGAGTTGCATTACCTTGGGGAATAGGCGCTTCTTTTGTACGTCCTTGCGATAAAATTATCTCTGTTTCTGGTGATGGGGGATTTATGCAATCTTCAATGGAGCTAGAAACCGCAGTTCGTCTTAATACCAATATATTGCATATTATCTGGGTTGATAATGCTTATAATATGGTGGAGATGCAAGAAGAGGTAAAATATGGCCGTCCTTCTGGCGTAAAATTTGGTCCTATTGATTTTAAACGCTATGCAGAATCTTTTGGTGCTAAAGGATTTTCTGTTGAGTGCGCATCTCAACTTCGTGAAACCTTACGTAAAGCGATAGCTGTTGATGGTCCTGCTGTGTTAGCCATTCCTGTTGATTATCGTGATAACGATAAATTAATGAAGCACATTAATTATAATTTAATTATTTAGTAATAAGCCCCTCCAGTTAACGGATTAGTCATTAGAATGGAGGGGCATTT