Homologs in group_2499

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00185 FBDBKF_00185 44.9 Morganella morganii S1 - Phage antitermination protein Q
EHELCC_01360 EHELCC_01360 44.9 Morganella morganii S2 - Phage antitermination protein Q
NLDBIP_02100 NLDBIP_02100 44.9 Morganella morganii S4 - Phage antitermination protein Q
LHKJJB_03615 LHKJJB_03615 44.9 Morganella morganii S3 - Phage antitermination protein Q
HKOGLL_03430 HKOGLL_03430 44.9 Morganella morganii S5 - Phage antitermination protein Q

Distribution of the homologs in the orthogroup group_2499

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2499

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O48429 5.12e-31 110 45 1 112 3 Q Antitermination protein Q Enterobacteria phage H19B
P68923 9.12e-31 110 43 1 112 3 Q Antitermination protein Q Enterobacteria phage VT2-Sa
P68922 9.12e-31 110 43 1 112 3 Q Antitermination protein Q Escherichia phage 933W
Q47274 5.78e-29 105 42 1 115 3 quuD Prophage antitermination protein Q homolog QuuD Escherichia coli (strain K12)
Q9T1U3 1.23e-12 63 30 2 110 3 5 Probable antitermination protein Q Acyrthosiphon pisum secondary endosymbiont phage 1

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04845
Feature type CDS
Gene -
Product antiterminator Q family protein
Location 1062555 - 1062938 (strand: 1)
Length 384 (nucleotides) / 127 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2499
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF06530 Phage antitermination protein Q

Protein Sequence

MQKISKLMEAWGSWVVNNNLYINTLTINKRENVPIRVKLRKACTDRQGIIVSVCMSKLLKNHKKDYELLVDYYVFGQTFIQLAQAHRCSDTYIGKKLKKAEGIVEGMLIMAELIFIIEKNENSTLRS

Flanking regions ( +/- flanking 50bp)

AAACAGTGTGATCATATAGTGTATTTTAGAAAGATAAACAGGATGTTTATATGCAAAAAATATCAAAACTGATGGAAGCCTGGGGCTCATGGGTTGTAAATAATAATTTATATATCAATACATTAACAATAAATAAACGTGAAAATGTGCCAATACGTGTTAAATTAAGAAAAGCCTGTACTGATCGCCAAGGCATCATAGTCTCGGTATGTATGAGTAAACTACTAAAAAATCATAAAAAAGATTATGAATTACTAGTCGATTACTATGTATTTGGACAAACATTTATTCAATTAGCACAAGCGCATCGATGCTCTGATACTTATATCGGAAAAAAACTCAAAAAAGCAGAAGGCATTGTGGAAGGGATGTTAATTATGGCCGAATTAATATTTATTATTGAGAAAAATGAAAATAGTACTTTACGATCGTAATTTAAGGCTTATTCTAAACAAACTGATAGCAAATAAAGAATTGCAATAAT