Homologs in group_107

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00185 FBDBKF_00185 100.0 Morganella morganii S1 - Phage antitermination protein Q
FBDBKF_12355 FBDBKF_12355 37.2 Morganella morganii S1 - Antitermination protein Q
FBDBKF_12850 FBDBKF_12850 27.1 Morganella morganii S1 - Phage antitermination protein Q
NLDBIP_02100 NLDBIP_02100 100.0 Morganella morganii S4 - Phage antitermination protein Q
LHKJJB_03615 LHKJJB_03615 100.0 Morganella morganii S3 - Phage antitermination protein Q
HKOGLL_03430 HKOGLL_03430 100.0 Morganella morganii S5 - Phage antitermination protein Q
F4V73_RS06180 F4V73_RS06180 23.2 Morganella psychrotolerans - antiterminator Q family protein
PMI_RS04475 PMI_RS04475 43.8 Proteus mirabilis HI4320 - antiterminator Q family protein
PMI_RS04675 PMI_RS04675 42.0 Proteus mirabilis HI4320 - antiterminator Q family protein
PMI_RS04845 PMI_RS04845 44.9 Proteus mirabilis HI4320 - antiterminator Q family protein

Distribution of the homologs in the orthogroup group_107

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_107

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O48429 1.14e-62 191 64 2 148 3 Q Antitermination protein Q Enterobacteria phage H19B
P68923 4.85e-60 185 62 2 148 3 Q Antitermination protein Q Enterobacteria phage VT2-Sa
P68922 4.85e-60 185 62 2 148 3 Q Antitermination protein Q Escherichia phage 933W
Q47274 1e-54 171 65 0 120 3 quuD Prophage antitermination protein Q homolog QuuD Escherichia coli (strain K12)
Q9T1U3 1.8e-27 102 42 1 121 3 5 Probable antitermination protein Q Acyrthosiphon pisum secondary endosymbiont phage 1

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_01360
Feature type CDS
Gene -
Product Phage antitermination protein Q
Location 277496 - 277933 (strand: 1)
Length 438 (nucleotides) / 145 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_107
Orthogroup size 11
N. genomes 7

Actions

Genomic region

Domains

PF06530 Phage antitermination protein Q

Protein Sequence

MRDIRQVLERWGAWVVDNQESVYWSPIAAGFKGLIPEKVKSRQSCSDDDALVISGIMAKLNIRNSDMHDLLFDYYVFGKTFIRLAKKYGCSDTHIGKKLQKAEGLVEGMLIMGDVKLEMDATSHRGGMRTFMNKLHDLKINTLRS

Flanking regions ( +/- flanking 50bp)

TTTATCGGAAGATATTAAATCTCATAGCCTGCAAAATAACGAGGTAATGTATGCGTGATATTCGCCAGGTGTTAGAACGGTGGGGGGCTTGGGTTGTTGATAATCAGGAATCAGTATATTGGTCACCAATAGCTGCCGGGTTTAAAGGGCTGATCCCTGAAAAAGTTAAGAGTCGGCAATCATGCAGTGATGATGATGCTCTGGTGATATCCGGCATTATGGCAAAACTGAATATCCGTAACAGTGATATGCATGATCTGCTTTTTGACTACTATGTTTTCGGTAAAACGTTTATCCGGTTGGCGAAGAAATACGGGTGCTCAGACACTCACATAGGGAAAAAACTCCAGAAGGCAGAAGGGCTGGTGGAAGGAATGCTCATAATGGGAGATGTAAAACTGGAAATGGACGCTACATCACATCGTGGAGGTATGCGGACATTTATGAACAAATTACATGATTTAAAAATTAATACTTTACGATCGTAAAAAAGACGCTATTGTGATCAGAGTTATTTCTATGTCGTATTGATTGCAAA