Homologs in group_2442

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19980 FBDBKF_19980 74.0 Morganella morganii S1 ydcH DUF465 domain-containing protein
EHELCC_07635 EHELCC_07635 74.0 Morganella morganii S2 ydcH DUF465 domain-containing protein
NLDBIP_07960 NLDBIP_07960 74.0 Morganella morganii S4 ydcH DUF465 domain-containing protein
LHKJJB_06305 LHKJJB_06305 74.0 Morganella morganii S3 ydcH DUF465 domain-containing protein
HKOGLL_19160 HKOGLL_19160 74.0 Morganella morganii S5 ydcH DUF465 domain-containing protein
F4V73_RS02390 F4V73_RS02390 80.8 Morganella psychrotolerans - DUF465 domain-containing protein

Distribution of the homologs in the orthogroup group_2442

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2442

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACW7 2.6e-22 84 58 0 67 4 ydcH Uncharacterized protein YdcH Shigella flexneri
P0ACW6 2.6e-22 84 58 0 67 4 ydcH Uncharacterized protein YdcH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04810
Feature type CDS
Gene -
Product DUF465 domain-containing protein
Location 1058350 - 1058571 (strand: 1)
Length 222 (nucleotides) / 73 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2442
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04325 Protein of unknown function (DUF465)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2841 Function unknown (S) S Uncharacterized conserved protein YdcH, DUF465 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09794 uncharacterized protein - -

Protein Sequence

MFPEYRDLIAKLRQTDPHFRALFEQHNELDHKIVRLEHRDRRGYGEEVVELKKQKLRLKEEIHQILKNPPEDE

Flanking regions ( +/- flanking 50bp)

TTAAAAGTAGTATGACACTCATCACTCATTGATAATGGAAGGTAGGTAATATGTTTCCAGAATATCGTGATTTAATTGCTAAGCTTCGTCAAACTGATCCCCATTTCCGAGCCCTGTTTGAACAACATAATGAACTTGACCATAAAATTGTACGCTTAGAACACCGAGATAGGCGAGGATATGGAGAAGAAGTTGTTGAATTAAAAAAACAAAAATTACGTCTAAAAGAAGAAATACATCAGATCTTAAAAAATCCCCCAGAAGATGAGTAGCACAAATAAGTACTGTATGTAATTAATAAAATTAAATAGAAATAATAAAA