Homologs in group_2470

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19980 FBDBKF_19980 100.0 Morganella morganii S1 ydcH DUF465 domain-containing protein
EHELCC_07635 EHELCC_07635 100.0 Morganella morganii S2 ydcH DUF465 domain-containing protein
LHKJJB_06305 LHKJJB_06305 100.0 Morganella morganii S3 ydcH DUF465 domain-containing protein
HKOGLL_19160 HKOGLL_19160 100.0 Morganella morganii S5 ydcH DUF465 domain-containing protein
F4V73_RS02390 F4V73_RS02390 86.3 Morganella psychrotolerans - DUF465 domain-containing protein
PMI_RS04810 PMI_RS04810 74.0 Proteus mirabilis HI4320 - DUF465 domain-containing protein

Distribution of the homologs in the orthogroup group_2470

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2470

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACW7 2.2e-23 87 62 0 67 4 ydcH Uncharacterized protein YdcH Shigella flexneri
P0ACW6 2.2e-23 87 62 0 67 4 ydcH Uncharacterized protein YdcH Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07960
Feature type CDS
Gene ydcH
Product DUF465 domain-containing protein
Location 2163 - 2384 (strand: 1)
Length 222 (nucleotides) / 73 (amino acids)
In genomic island -

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2470
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04325 Protein of unknown function (DUF465)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2841 Function unknown (S) S Uncharacterized conserved protein YdcH, DUF465 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09794 uncharacterized protein - -

Protein Sequence

MFPEYRDLISHLRQNSHQFRTLFDKHNQLDHEIARLEKSDRSGYSEEVVELKKQKLRLKEEIHQLLKDPPEDD

Flanking regions ( +/- flanking 50bp)

CTGAAATCGCAGATGATGGCACTATAGTCACTGACAGGAGGTAAGTTGTTATGTTTCCGGAATACCGTGATTTGATCTCCCATCTTCGCCAAAATAGTCATCAGTTTCGCACGCTGTTTGATAAACACAATCAACTCGATCATGAAATTGCCCGTCTGGAAAAATCAGACAGAAGCGGCTACAGTGAGGAAGTGGTGGAACTGAAAAAACAGAAATTACGCCTGAAAGAAGAAATCCACCAGCTTCTTAAAGATCCGCCGGAAGATGACTGAATTTCCTTAATATGCCATCGGTTAATCCGGTGGCTTTTTGTTTACGGGGA