Homologs in group_4573

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4573

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4573

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76063 2.97e-30 105 67 0 67 3 ydaS Uncharacterized protein YdaS Escherichia coli (strain K12)
Q37907 0.000264 38 29 0 68 3 cro Regulatory protein cro Pseudomonas phage D3

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04440
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 990511 - 990750 (strand: 1)
Length 240 (nucleotides) / 79 (amino acids)
In genomic island GI56

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4573
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF15943 Bacterial toxin YdaS

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4197 Transcription (K) K DNA-binding transcriptional regulator YdaS, prophage-encoded, Cro superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22302 transcriptional repressor of cell division inhibition gene dicB - -

Protein Sequence

MDQISATTAIKKACNYVGGQSEMAKRLGISPPTVNQWINGTRKIPARRCPEIEKVTSGVVRCEELRPDVDWSYLRGTQQ

Flanking regions ( +/- flanking 50bp)

TAGGCTTAGCCTAACATTGTATTTCAATATAGGCCGGAGGTAATTGAATAATGGATCAAATAAGTGCCACAACCGCAATAAAAAAAGCATGTAATTATGTCGGTGGGCAGTCTGAAATGGCTAAACGCTTGGGTATTTCACCGCCTACAGTAAATCAATGGATCAATGGAACTCGAAAAATTCCAGCACGACGTTGCCCTGAAATAGAAAAAGTAACTTCAGGAGTGGTTCGATGTGAAGAACTAAGGCCTGATGTTGATTGGTCTTATTTACGGGGAACTCAACAATGATTTTTATACTTACTTTATTGAAATAAACAATAGCAAAACAGTTTAAAGCA