Homologs in group_1944

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14580 FBDBKF_14580 57.2 Morganella morganii S1 phoQ two-component system sensor histidine kinase PhoQ
EHELCC_15385 EHELCC_15385 57.2 Morganella morganii S2 phoQ two-component system sensor histidine kinase PhoQ
NLDBIP_15915 NLDBIP_15915 57.2 Morganella morganii S4 phoQ two-component system sensor histidine kinase PhoQ
LHKJJB_15925 LHKJJB_15925 57.2 Morganella morganii S3 phoQ two-component system sensor histidine kinase PhoQ
HKOGLL_15045 HKOGLL_15045 57.2 Morganella morganii S5 phoQ two-component system sensor histidine kinase PhoQ
F4V73_RS07375 F4V73_RS07375 58.6 Morganella psychrotolerans phoQ two-component system sensor histidine kinase PhoQ

Distribution of the homologs in the orthogroup group_1944

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1944

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z7H3 0.0 543 54 2 480 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhi
P0DM80 0.0 542 54 2 480 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP94 0.0 542 54 2 480 2 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA0 0.0 542 54 2 480 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain SL1344)
D0ZV89 0.0 542 54 2 480 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ0 0.0 542 54 2 480 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC4 0.0 542 54 2 480 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella choleraesuis (strain SC-B67)
Q8X739 0.0 536 53 3 480 3 phoQ Sensor protein PhoQ Escherichia coli O157:H7
Q83RR1 0.0 534 54 3 474 3 phoQ Virulence sensor protein PhoQ Shigella flexneri
Q8FIB8 0.0 533 53 3 474 3 phoQ Sensor protein PhoQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23837 0.0 533 53 3 474 1 phoQ Sensor protein PhoQ Escherichia coli (strain K12)
Q9I4F8 1.53e-54 192 42 3 266 3 phoQ Two-component sensor PhoQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0I2 4.9e-46 169 35 3 271 3 carS Sensor protein kinase CarS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AE82 3.91e-23 105 31 9 264 1 cpxA Sensor histidine kinase CpxA Escherichia coli (strain K12)
P0AE83 3.91e-23 105 31 9 264 3 cpxA Sensor protein CpxA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE84 3.91e-23 105 31 9 264 3 cpxA Sensor protein CpxA Escherichia coli O157:H7
P30847 3.21e-22 102 26 7 281 1 baeS Signal transduction histidine-protein kinase BaeS Escherichia coli (strain K12)
A0A0H3GPN8 2.55e-20 97 29 9 265 2 cpxA Sensor histidine kinase CpxA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P9WGK7 5.95e-19 92 26 10 284 1 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK6 5.95e-19 92 26 10 284 3 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z9 5.95e-19 92 26 10 284 3 prrB Sensor-type histidine kinase PrrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45336 1.07e-17 89 29 8 292 1 qseC Sensor protein QseC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O33071 1.07e-16 85 26 10 284 3 prrB Sensor-type histidine kinase PrrB Mycobacterium leprae (strain TN)
Q6GGK7 1.58e-15 82 24 3 228 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MRSA252)
Q8FK37 1.96e-15 82 22 8 323 3 cusS Sensor histidine kinase CusS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8NWF3 2.34e-15 82 24 3 228 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MW2)
Q6G973 2.34e-15 82 24 3 228 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MSSA476)
Q5HFT1 2.34e-15 82 24 3 228 2 srrB Sensor protein SrrB Staphylococcus aureus (strain COL)
Q2FY80 2.34e-15 82 24 3 228 3 srrB Sensor protein SrrB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9L523 2.47e-15 82 24 3 228 1 srrB Sensor protein SrrB Staphylococcus aureus
Q7A5H7 3.49e-15 81 24 3 228 1 srrB Sensor protein SrrB Staphylococcus aureus (strain N315)
Q99TZ9 3.49e-15 81 24 3 228 3 srrB Sensor protein SrrB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8XBY4 4.57e-15 80 22 8 328 3 cusS Sensor histidine kinase CusS Escherichia coli O157:H7
Q742C0 1.28e-14 79 27 10 272 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P77485 1.36e-14 79 22 8 325 1 cusS Sensor histidine kinase CusS Escherichia coli (strain K12)
P18392 2.36e-14 78 27 11 302 1 rstB Sensor protein RstB Escherichia coli (strain K12)
A0QBR0 4.84e-14 77 26 10 272 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium avium (strain 104)
Q8GP19 1.05e-13 76 26 9 280 1 rssA Swarming motility regulation sensor protein RssA Serratia marcescens
A0R3I7 1.12e-13 76 27 12 270 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O32193 1.73e-13 75 21 8 284 1 cssS Sensor histidine kinase CssS Bacillus subtilis (strain 168)
Q9HV31 1.92e-13 75 28 8 269 2 pmrB Sensor protein kinase PmrB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0PWB3 2.33e-13 75 25 11 287 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium ulcerans (strain Agy99)
P42245 2.8e-13 73 25 9 251 3 ycbM Sensor histidine kinase YcbM Bacillus subtilis (strain 168)
O34638 5.34e-13 74 25 6 241 3 ykoH Sensor histidine kinase YkoH Bacillus subtilis (strain 168)
Q47457 5.81e-13 74 25 11 290 3 pcoS Probable sensor protein PcoS Escherichia coli
Q6GIT7 7.87e-13 73 27 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MRSA252)
E0X9C7 1.1e-12 74 25 6 281 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
E0X9C7 0.000255 47 33 1 74 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
A5W4E3 1.58e-12 73 25 4 217 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5W4E3 0.000249 47 33 1 74 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q7A1J2 2.2e-12 72 26 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MW2)
Q6GBC5 2.2e-12 72 26 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MSSA476)
Q7A6V4 2.2e-12 72 26 8 263 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain N315)
Q99VR8 2.2e-12 72 26 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSM6 2.2e-12 72 26 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8KIY1 2.76e-12 73 24 6 275 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9HZ47 2.96e-12 72 27 10 271 1 gtrS Sensor histidine kinase GtrS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q840P7 3.47e-12 71 26 8 263 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Newman)
Q5HHW5 3.59e-12 71 26 8 263 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain COL)
Q2G2U1 3.59e-12 71 26 8 263 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT5 3.59e-12 71 26 8 263 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain USA300)
Q55932 6.39e-12 71 28 6 213 1 rppB Sensor histidine kinase RppB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HPC4 8.7e-12 70 23 15 421 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P94414 1.11e-11 70 21 9 329 3 yclK Sensor histidine kinase YclK Bacillus subtilis (strain 168)
Q8CSL7 1.22e-11 70 23 15 421 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P35164 1.24e-11 70 26 5 215 1 resE Sensor histidine kinase ResE Bacillus subtilis (strain 168)
Q9Z5G7 2.93e-11 69 26 11 275 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium leprae (strain TN)
O34989 4.56e-11 68 25 11 328 3 yvrG Sensor histidine kinase YvrG Bacillus subtilis (strain 168)
A1TEL6 8.12e-11 67 24 11 282 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q55630 8.81e-11 67 25 6 221 1 sasA Adaptive-response sensory kinase SasA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DMT2 9.5e-11 67 28 8 235 1 sasA Adaptive-response sensory kinase SasA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P9WGL1 1.64e-10 67 25 12 279 1 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL0 1.64e-10 67 25 12 279 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U124 1.64e-10 67 25 12 279 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KHB8 1.64e-10 67 24 11 279 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X3 1.64e-10 67 24 11 279 1 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8DMC5 1.66e-10 66 28 10 216 1 hik2 Sensor histidine kinase Hik2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q02541 1.78e-10 66 25 9 259 3 copS Sensor protein CopS Pseudomonas syringae pv. tomato
P08982 1.97e-10 66 35 2 109 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NIL4 1.97e-10 66 35 2 109 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain SL1344)
A7HD43 2.21e-10 65 26 9 240 1 gchK Globin-coupled histidine kinase Anaeromyxobacter sp. (strain Fw109-5)
Q8CTI3 2.91e-10 65 24 6 259 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR29 2.91e-10 65 24 6 259 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P41406 3.41e-10 65 36 2 108 3 envZ Sensor histidine kinase EnvZ Salmonella typhi
P0A4I6 3.42e-10 65 26 5 229 3 ciaH Sensor protein CiaH Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4I5 3.42e-10 65 26 5 229 3 ciaH Sensor protein CiaH Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A4P7TSF2 3.44e-10 65 34 1 90 1 envZ Sensor histidine kinase EnvZ Shigella flexneri serotype 5a (strain M90T)
P0AEJ5 3.44e-10 65 34 1 90 1 envZ Sensor histidine kinase EnvZ Shigella flexneri
P0AEJ4 3.44e-10 65 34 1 90 1 envZ Sensor histidine kinase EnvZ Escherichia coli (strain K12)
Q49XM6 3.48e-10 65 23 18 448 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5A2P0 4.43e-10 65 25 7 235 3 walK Sensor protein kinase WalK (Fragment) Mammaliicoccus sciuri
A3Q5L8 4.61e-10 65 25 11 284 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain JLS)
Q1B3X9 5.79e-10 65 25 11 284 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain MCS)
A1UL69 5.79e-10 65 25 11 284 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain KMS)
O69729 7.16e-10 64 28 10 249 1 tcrY Probable sensor histidine kinase TcrY Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P71380 7.43e-10 64 24 6 225 3 phoR Phosphate regulon sensor protein PhoR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30855 8.18e-10 65 26 11 248 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q4A159 9.54e-10 64 26 7 230 3 walK Sensor protein kinase WalK Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P21865 9.95e-10 64 31 12 229 1 kdpD Sensor protein KdpD Escherichia coli (strain K12)
Q8CU87 1.11e-09 64 25 8 232 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK19 1.11e-09 64 25 8 232 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8ZLZ9 1.16e-09 63 26 5 243 3 qseC Sensor protein QseC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q70FG9 1.29e-09 63 25 10 299 3 pmrB Sensor histidine kinase PmrB Pectobacterium parmentieri
Q45614 1.52e-09 63 24 6 210 1 walK Sensor histidine kinase WalK Bacillus subtilis (strain 168)
P58402 1.54e-09 64 24 9 245 3 evgS Sensor protein EvgS Escherichia coli O157:H7
P9WGL2 1.71e-09 63 26 10 238 3 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P45608 1.74e-09 63 23 4 221 3 phoR Phosphate regulon sensor protein PhoR Klebsiella pneumoniae
P9WGL3 1.74e-09 63 26 10 238 1 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8Z3P2 2.36e-09 63 26 5 243 3 qseC Sensor protein QseC Salmonella typhi
Q04943 2.71e-09 63 35 1 92 3 afsQ2 Signal transduction histidine-protein kinase AfsQ2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4L6C5 3.16e-09 62 25 7 233 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus haemolyticus (strain JCSC1435)
Q8DPL8 5.59e-09 62 26 5 201 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNH9 5.59e-09 62 26 5 201 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q7BWI3 5.62e-09 61 23 7 234 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A6QD58 5.8e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Newman)
Q7A215 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MW2)
A8YYU2 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD71 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MSSA476)
Q7A8E0 6.39e-09 62 25 8 232 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain N315)
Q7A305 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJX6 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain COL)
Q2YUQ2 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INR0 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH9)
Q2G2U4 6.39e-09 62 25 8 232 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN7 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300)
A6TXG9 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH1)
A7WWQ7 6.39e-09 62 25 8 232 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7A0W5 6.53e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MW2)
Q6G9E7 6.53e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MSSA476)
Q7A5N3 6.53e-09 61 24 11 311 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain N315)
Q7A2R7 6.53e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG05 6.53e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain COL)
Q9KJN3 6.53e-09 61 24 11 311 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH24 6.53e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain USA300)
Q6GGZ4 7.13e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MRSA252)
Q6GKS6 7.41e-09 61 25 7 230 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MRSA252)
Q2YY04 7.79e-09 61 24 11 311 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain bovine RF122 / ET3-1)
P23545 9.75e-09 61 25 6 248 1 phoR Alkaline phosphatase synthesis sensor protein PhoR Bacillus subtilis (strain 168)
Q9RDT3 1.15e-08 60 25 8 232 1 walK Sensor protein kinase WalK (Fragment) Staphylococcus aureus
Q4LAJ8 2.15e-08 60 25 7 230 3 walK Sensor protein kinase WalK Staphylococcus haemolyticus (strain JCSC1435)
A0QR01 2.4e-08 59 21 3 220 1 senX3 Sensor-like histidine kinase SenX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P23621 2.94e-08 59 22 5 231 3 phoR Phosphate regulon sensor protein PhoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8X524 3.43e-08 59 28 8 268 2 qseC Sensor protein QseC Escherichia coli O157:H7
Q2YZ23 4.13e-08 59 23 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q49ZT9 4.87e-08 58 31 1 100 3 hssS Heme sensor protein HssS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P30844 6.18e-08 58 23 7 274 1 basS Sensor protein BasS Escherichia coli (strain K12)
P96368 8.64e-08 58 25 8 269 1 trcS Sensor histidine kinase TrcS Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P40719 8.65e-08 58 27 8 268 1 qseC Sensor protein QseC Escherichia coli (strain K12)
Q7A3X0 9.11e-08 58 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain N315)
Q99RR5 9.11e-08 58 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE3 9.11e-08 58 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain JH9)
A6U489 9.11e-08 58 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain JH1)
A7X5Y6 9.11e-08 58 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain Mu3 / ATCC 700698)
P08401 1.03e-07 57 27 8 205 1 creC Sensor protein CreC Escherichia coli (strain K12)
P76339 1.08e-07 57 27 8 237 1 hprS Sensor histidine kinase HprS Escherichia coli (strain K12)
Q8NV46 1.16e-07 57 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MW2)
Q6G6V8 1.16e-07 57 22 6 271 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MSSA476)
O34427 1.33e-07 57 34 3 100 1 citS Sensor protein CitS Bacillus subtilis (strain 168)
Q7V6P7 1.61e-07 57 22 6 233 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9313)
A8Z553 1.68e-07 57 32 1 96 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain USA300 / TCH1516)
A6QJK4 1.68e-07 57 32 1 96 1 hssS Heme sensor protein HssS Staphylococcus aureus (strain Newman)
Q5HDJ3 1.68e-07 57 32 1 96 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain COL)
Q2FVQ8 1.68e-07 57 32 1 96 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED4 1.68e-07 57 32 1 96 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain USA300)
Q6GE72 1.9e-07 57 32 1 96 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MRSA252)
A2C884 1.93e-07 56 22 6 233 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9303)
P42422 2.38e-07 56 22 5 219 3 yxdK Sensor histidine kinase YxdK Bacillus subtilis (strain 168)
Q8YR50 2.47e-07 56 35 2 95 3 sasA Adaptive-response sensory kinase SasA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3M8A7 2.82e-07 56 35 2 95 3 sasA Adaptive-response sensory kinase SasA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2J946 2.92e-07 56 29 4 134 3 sasA Adaptive-response sensory kinase SasA Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9ZHD4 4.48e-07 55 23 11 294 3 silS Probable sensor kinase SilS Salmonella typhimurium
Q9RC53 4.56e-07 55 24 12 237 3 citS Sensor protein CitS Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P52101 5.68e-07 55 26 11 301 1 glrK Sensor histidine kinase GlrK Escherichia coli (strain K12)
B1WYT4 5.86e-07 55 37 2 95 3 sasA Adaptive-response sensory kinase SasA Crocosphaera subtropica (strain ATCC 51142 / BH68)
B0JK50 7.36e-07 55 28 5 153 3 sasA Adaptive-response sensory kinase SasA Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P73276 9e-07 54 35 4 102 1 hik2 Sensor histidine kinase Hik2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8XA47 9.19e-07 55 26 11 301 1 qseE Sensor histidine kinase QseE Escherichia coli O157:H7
A0QTK3 1.3e-06 54 26 9 213 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q07737 1.53e-06 54 25 11 240 3 chvG Sensor protein ChvG Agrobacterium fabrum (strain C58 / ATCC 33970)
P10047 1.56e-06 54 36 4 112 3 dctB C4-dicarboxylate transport sensor protein DctB Rhizobium leguminosarum
Q3AYV8 1.78e-06 53 24 7 233 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9902)
B7K3M6 1.97e-06 53 27 3 137 3 sasA Adaptive-response sensory kinase SasA Rippkaea orientalis (strain PCC 8801 / RF-1)
Q44007 2.15e-06 53 23 6 273 2 czcS Sensor protein CzcS Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P77510 2.17e-06 53 35 5 104 1 dpiB Sensor histidine kinase DpiB Escherichia coli (strain K12)
I1WSZ3 2.82e-06 53 21 10 280 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain 1026b)
P0DMK6 3.63e-06 53 21 10 280 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain K96243)
Q0IBF4 4.3e-06 52 22 7 228 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9311)
Q2JKD9 4.74e-06 52 25 9 229 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-2-3B'a(2-13))
P08400 4.96e-06 52 22 5 226 1 phoR Phosphate regulon sensor protein PhoR Escherichia coli (strain K12)
O07778 5.03e-06 50 31 1 124 1 Rv0600c Sensor histidine kinase component HK1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK8 5.11e-06 52 23 6 213 3 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P59963 5.11e-06 52 23 6 213 3 mtrB Sensor histidine kinase MtrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGK9 5.38e-06 52 23 6 213 1 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P42707 6.35e-06 52 21 9 333 3 nisK Nisin biosynthesis sensor protein NisK Lactococcus lactis subsp. lactis
Q08430 7.12e-06 52 21 7 224 3 kinB Sporulation kinase B Bacillus subtilis (strain 168)
P16497 8.01e-06 52 22 7 214 1 kinA Sporulation kinase A Bacillus subtilis (strain 168)
P26489 8.06e-06 52 26 7 201 3 fixL Sensor protein FixL Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O34206 9.13e-06 52 24 6 224 1 kinB Alginate biosynthesis sensor protein KinB Pseudomonas aeruginosa
P0A4I8 9.42e-06 51 23 5 247 3 cutS Sensor protein CutS Streptomyces lividans
P0A4I7 9.42e-06 51 23 5 247 3 cutS Sensor protein CutS Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P39453 9.5e-06 52 28 1 99 1 torS Sensor protein TorS Escherichia coli (strain K12)
Q7U871 1.04e-05 51 22 6 228 3 sasA Adaptive-response sensory kinase SasA Parasynechococcus marenigrum (strain WH8102)
P23222 1.04e-05 51 24 4 225 1 fixL Sensor protein FixL Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P94608 1.17e-05 52 34 2 96 3 kdpD Sensor protein KdpD Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q06240 1.18e-05 51 23 5 197 1 vanS Sensor protein VanS Enterococcus faecium
O14002 1.21e-05 52 23 9 215 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2JWK9 1.25e-05 51 24 7 204 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-3-3Ab)
Q7D9K1 1.26e-05 51 31 1 124 3 MT0630 Probable sensor histidine kinase HK Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P51392 1.29e-05 51 23 9 230 3 ycf26 Uncharacterized sensor-like histidine kinase ycf26 Porphyra purpurea
Q9HUI3 1.7e-05 51 27 6 207 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7KFU0 1.79e-05 50 29 3 127 3 sasA Adaptive-response sensory kinase SasA Gloeothece citriformis (strain PCC 7424)
P52687 1.83e-05 50 27 5 141 1 citA Sensor histidine kinase CitA Klebsiella pneumoniae
P9WGK5 2.04e-05 50 26 2 117 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK4 2.04e-05 50 26 2 117 2 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A601 2.04e-05 50 26 2 117 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P39664 2.18e-05 50 26 7 241 1 sphS Sensor protein SphS Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P36557 2.31e-05 50 23 9 268 1 basS Sensor protein BasS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q54SP4 2.51e-05 50 23 5 218 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P45609 2.6e-05 50 21 4 221 3 phoR Phosphate regulon sensor protein PhoR Shigella dysenteriae
Q44930 2.6e-05 50 21 9 276 4 gtcS Sensor protein GtcS Aneurinibacillus migulanus
Q1XD95 2.86e-05 50 24 9 220 3 ycf26 Uncharacterized sensor-like histidine kinase ycf26 Neopyropia yezoensis
P13633 3.51e-05 50 29 5 122 1 dctB C4-dicarboxylate transport sensor protein DctB Rhizobium meliloti (strain 1021)
P58356 4.3e-05 50 28 1 99 3 torS Sensor protein TorS Escherichia coli O157:H7
Q9CCJ1 7.2e-05 48 22 6 213 3 mtrB Sensor histidine kinase MtrB Mycobacterium leprae (strain TN)
Q03069 7.49e-05 48 20 7 215 3 degM Sensor protein DegM Bacillus sp. (strain B21-2)
Q8CRA8 9.28e-05 48 23 7 202 3 hssS Heme sensor protein HssS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q93CB7 0.000119 48 20 12 363 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q02482 0.000143 48 27 3 123 3 Sfri_3689 Putative sensor protein Sfri_3689 Shewanella frigidimarina (strain NCIMB 400)
P37461 0.000144 48 42 3 75 2 zraS Sensor histidine kinase ZraS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z332 0.00015 47 42 3 75 3 zraS Sensor histidine kinase ZraS Salmonella typhi
Q52969 0.000221 47 27 5 137 3 R01002 Uncharacterized sensor-like histidine kinase R01002 Rhizobium meliloti (strain 1021)
P54883 0.000222 47 29 2 104 3 senX3 Sensor-like histidine kinase SenX3 Mycobacterium leprae (strain TN)
Q4L8M0 0.00024 47 21 11 315 3 hssS Heme sensor protein HssS Staphylococcus haemolyticus (strain JCSC1435)
Q49VK4 0.000366 46 22 8 270 3 graS Sensor histidine kinase GraS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8ZPP5 0.000377 47 28 2 103 1 ssrA Sensor histidine kinase SsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8E3C7 0.00051 46 24 7 209 3 dltS Sensor protein DltS Streptococcus agalactiae serotype III (strain NEM316)
Q8D5Z6 0.000678 46 21 9 241 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q7MD16 0.000702 46 21 9 241 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q1RJB3 0.000741 45 29 4 113 3 RBE_0470 Putative sensor histidine kinase NtrY-like Rickettsia bellii (strain RML369-C)
Q5HLN1 0.000822 45 22 7 202 3 hssS Heme sensor protein HssS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0DMC5 0.000831 45 30 3 107 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P0DMC6 0.00089 45 30 3 107 1 rcsC Sensor histidine kinase RcsC Escherichia coli
P33113 0.001 45 25 10 235 3 spaK Sensor histidine kinase SpaK Bacillus subtilis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04345
Feature type CDS
Gene phoQ
Product two-component system sensor histidine kinase PhoQ
Location 976188 - 977651 (strand: -1)
Length 1464 (nucleotides) / 487 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1944
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00512 His Kinase A (phospho-acceptor) domain
PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
PF08918 PhoQ Sensor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0642 Signal transduction mechanisms (T) T Signal transduction histidine kinase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07637 two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3] Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Cationic antimicrobial peptide (CAMP) resistance, protease PgtE

Protein Sequence

MHKKQRSPFSLRTRFLLATSAIILALTLSYGLVAIVGSIVSFDKTTFMLMRSQSNLYYSLAQWKDGQLQIEFPTNLNNNNTSLVVIFDEKGNVLWTPTDLPQVIPNSIAPKWRNKEGLFEISVNVKTTRFMLQQLPQYRAYLKKLNEYSSNDTLTHSVVINHYPAADNMPYLSIAVIDPIPQSLQNVSRVWDWFLYILLANFLLVIPLIWLAAHWSLRPIKSIIEQISALEKGTRDNLDENPPKELKGLVYNLNILLRNERNRYSKYRTSLSDLTHSLKTPLAVLQSTLRALRAGKQMSIEQAEPIMQSQIERISQQVGYYLHRASLHGDHDITTRKLHSLSGLLDNLCSALNKVYQSKGVDITLNVSPEMMWLGEKNDFMEVMGNVLDNACKYCLEFVEINVSHDDNCVIITVDDDGPGVSPEKRELIFQRGTRADTLRPGQGLGLSIAVDIIEQYNGDITITDSPLGGARLIVTFAEQQLTTEIE

Flanking regions ( +/- flanking 50bp)

CATTGTAACTGTACGTGGACAAGGTTATCGTTTTGATATGAAAGCTTAATATGCATAAAAAACAACGTTCGCCCTTCTCTTTACGAACAAGATTTTTACTTGCCACCAGCGCCATTATTTTAGCACTGACACTCTCTTATGGTTTGGTTGCCATAGTCGGTTCTATTGTCAGTTTTGATAAAACGACTTTTATGCTAATGCGTAGCCAAAGTAATCTCTACTATAGCTTAGCGCAATGGAAAGATGGGCAATTGCAGATTGAATTTCCGACTAACCTCAATAACAACAACACATCGCTGGTGGTTATTTTCGACGAGAAAGGCAATGTGCTATGGACGCCAACGGATTTACCTCAGGTGATCCCAAACAGTATCGCGCCAAAATGGCGCAATAAAGAAGGCTTATTTGAAATTAGTGTGAATGTTAAAACGACACGTTTTATGTTACAGCAACTGCCTCAATATCGAGCCTATCTAAAAAAACTCAACGAATATTCAAGTAATGATACCTTAACGCATTCCGTGGTTATTAATCACTATCCTGCGGCGGATAATATGCCTTATCTATCCATTGCGGTTATCGATCCTATTCCTCAAAGTCTGCAAAATGTAAGTAGAGTCTGGGATTGGTTTCTCTATATATTACTAGCTAATTTTCTTTTGGTGATCCCATTAATTTGGTTAGCAGCCCATTGGAGTTTAAGGCCGATTAAATCCATTATTGAGCAGATCAGCGCGTTGGAAAAAGGCACTCGCGATAATTTAGATGAAAATCCTCCTAAAGAGCTCAAAGGATTAGTTTATAATCTCAACATTTTATTGCGTAATGAACGCAACCGTTATAGTAAATACCGTACCAGTTTATCTGATCTGACCCATAGCTTAAAAACCCCCCTTGCTGTTTTACAATCAACATTACGTGCTCTACGTGCTGGCAAACAAATGTCTATAGAACAAGCTGAGCCAATTATGCAAAGTCAAATTGAACGAATTTCACAGCAAGTTGGTTATTATTTACATCGAGCTTCTCTTCACGGCGATCACGATATAACAACACGTAAGCTCCACTCTTTATCAGGCTTACTTGACAATCTTTGTAGTGCACTTAATAAGGTCTATCAATCCAAAGGCGTTGATATAACATTAAATGTTTCCCCTGAAATGATGTGGTTAGGTGAAAAGAATGATTTTATGGAAGTCATGGGAAATGTACTTGATAATGCTTGTAAGTACTGTTTAGAGTTTGTCGAGATCAATGTAAGTCATGATGACAATTGTGTGATTATCACCGTAGATGATGATGGCCCAGGAGTCAGCCCAGAAAAAAGGGAGCTTATTTTTCAGCGTGGTACACGTGCAGATACATTGCGCCCAGGACAAGGCTTAGGATTATCAATTGCTGTTGATATTATTGAGCAGTATAACGGTGATATCACCATTACCGATAGTCCATTAGGGGGGGCGAGACTCATCGTCACCTTTGCTGAGCAACAACTCACTACTGAAATAGAGTAACGCTCTTCTCTATCAACTTATATTATTGCTGATTCAATTTAGGTCTTATC