Homologs in group_1990

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14655 FBDBKF_14655 70.7 Morganella morganii S1 ycfP alpha/beta hydrolase YcfP
EHELCC_15460 EHELCC_15460 70.7 Morganella morganii S2 ycfP alpha/beta hydrolase YcfP
NLDBIP_15990 NLDBIP_15990 70.7 Morganella morganii S4 ycfP alpha/beta hydrolase YcfP
LHKJJB_15850 LHKJJB_15850 70.7 Morganella morganii S3 ycfP alpha/beta hydrolase YcfP
HKOGLL_14970 HKOGLL_14970 70.7 Morganella morganii S5 ycfP alpha/beta hydrolase YcfP
F4V73_RS07450 F4V73_RS07450 72.4 Morganella psychrotolerans ycfP alpha/beta hydrolase YcfP

Distribution of the homologs in the orthogroup group_1990

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1990

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4TTI0 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella schwarzengrund (strain CVM19633)
C0Q783 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella paratyphi C (strain RKS4594)
A9N5J5 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5QXC6 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella enteritidis PT4 (strain P125109)
B5FK97 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella dublin (strain CT_02021853)
Q57QE5 2.79e-99 287 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella choleraesuis (strain SC-B67)
A9MGA5 4.33e-99 286 75 1 178 3 ycfP UPF0227 protein YcfP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P67366 1.03e-98 285 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67367 1.03e-98 285 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella typhi
B4T3P7 1.03e-98 285 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella newport (strain SL254)
B4TFI5 1.03e-98 285 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella heidelberg (strain SL476)
B5F8E4 1.03e-98 285 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella agona (strain SL483)
B5RB92 3.8e-98 284 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q6D673 5.22e-98 283 73 1 178 3 ECA1814 UPF0227 protein ECA1814 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5BAG6 8.27e-98 283 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella paratyphi A (strain AKU_12601)
Q5PGR9 8.27e-98 283 74 1 178 3 ycfP UPF0227 protein YcfP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7LSP9 8.36e-98 283 74 1 178 3 ycfP UPF0227 protein YcfP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C6DKR7 8.73e-98 283 73 1 178 3 PC1_2487 UPF0227 protein PC1_2487 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A9R0I6 4.14e-97 281 73 1 178 3 YpAngola_A2819 UPF0227 protein YpAngola_A2819 Yersinia pestis bv. Antiqua (strain Angola)
B2K730 4.14e-97 281 73 1 178 3 YPTS_2532 UPF0227 protein YPTS_2532 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q669N6 4.14e-97 281 73 1 178 3 YPTB2448 UPF0227 protein YPTB2448 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CI38 4.14e-97 281 73 1 178 3 YPN_2013 UPF0227 protein YPN_2013 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C6Q0 4.14e-97 281 73 1 178 3 YPA_1906 UPF0227 protein YPA_1906 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TLQ4 4.14e-97 281 73 1 178 3 YPDSF_1831 UPF0227 protein YPDSF_1831 Yersinia pestis (strain Pestoides F)
B1JI48 4.14e-97 281 73 1 178 3 YPK_1701 UPF0227 protein YPK_1701 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZFS2 4.14e-97 281 73 1 178 3 YPO1616 UPF0227 protein YPO1616/y1776/YP_2238 Yersinia pestis
A7FH42 4.14e-97 281 73 1 178 3 YpsIP31758_1593 UPF0227 protein YpsIP31758_1593 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JME5 6.86e-97 281 73 1 178 3 YE1706 UPF0227 protein YE1706 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GD38 1.53e-96 280 74 1 178 3 Spro_1925 UPF0227 protein Spro_1925 Serratia proteamaculans (strain 568)
P0A8E4 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Shigella flexneri
Q0T5S8 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Shigella flexneri serotype 5b (strain 8401)
B2U512 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LI36 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain SMS-3-5 / SECEC)
B6I9I6 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain SE11)
B7NAY6 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8E1 2.85e-96 279 73 1 178 1 ycfP UPF0227 protein YcfP Escherichia coli (strain K12)
P0A8E2 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIW6 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XA18 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain K12 / DH10B)
C4ZS48 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LX42 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O8 (strain IAI1)
B7MTN8 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O81 (strain ED1a)
B5YVX7 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8E3 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O157:H7
B7LG41 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain 55989 / EAEC)
B7MJ95 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPC4 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKL2 2.85e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NKH1 4.32e-96 279 73 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1IUF7 8.16e-96 278 72 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ66 8.16e-96 278 72 1 178 3 ycfP UPF0227 protein YcfP Escherichia coli O9:H4 (strain HS)
A8AHW2 1.21e-95 278 73 1 178 3 CKO_01948 UPF0227 protein CKO_01948 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XXG3 2.26e-95 277 73 1 178 3 KPK_3451 UPF0227 protein KPK_3451 Klebsiella pneumoniae (strain 342)
A6T7G7 2.26e-95 277 73 1 178 3 KPN78578_10770 UPF0227 protein KPN78578_10770 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5BFM7 4.18e-95 276 70 1 178 3 NT01EI_1813 UPF0227 protein NT01EI_1813 Edwardsiella ictaluri (strain 93-146)
A4W9C2 5.19e-93 271 71 1 178 3 Ent638_1623 UPF0227 protein Ent638_1623 Enterobacter sp. (strain 638)
Q9CMJ9 4.85e-92 268 68 1 179 3 PM0825 UPF0227 protein PM0825 Pasteurella multocida (strain Pm70)
P62479 9.24e-91 265 70 1 176 3 PBPRA2397 UPF0227 protein PBPRA2397 Photobacterium profundum (strain SS9)
Q7MIZ4 8.95e-90 263 68 1 176 3 VV2369 UPF0227 protein VV2369 Vibrio vulnificus (strain YJ016)
P59274 8.95e-90 263 68 1 176 3 VV1_2072 UPF0227 protein VV1_2072 Vibrio vulnificus (strain CMCP6)
A5F706 6.35e-89 261 68 1 178 3 VC0395_A1482 UPF0227 protein VC0395_A1482/VC395_2007 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KQV6 6.35e-89 261 68 1 178 3 VC_1892 UPF0227 protein VC_1892 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LNJ6 6.35e-89 261 68 1 178 3 VCM66_1816 UPF0227 protein VCM66_1816 Vibrio cholerae serotype O1 (strain M66-2)
A7MV27 6.35e-89 261 68 1 178 3 VIBHAR_01524 UPF0227 protein VIBHAR_01524 Vibrio campbellii (strain ATCC BAA-1116)
Q87R29 4.56e-88 258 67 1 178 3 VP0969 UPF0227 protein VP0969 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VH49 3.1e-86 254 64 1 178 3 VS_2073 UPF0227 protein VS_2073 Vibrio atlanticus (strain LGP32)
Q0HJG6 4.69e-85 251 66 1 176 3 Shewmr4_1727 UPF0227 protein Shewmr4_1727 Shewanella sp. (strain MR-4)
A0KXK2 1.09e-84 250 65 1 176 3 Shewana3_2292 UPF0227 protein Shewana3_2292 Shewanella sp. (strain ANA-3)
A6WP02 8.27e-84 248 66 1 176 3 Shew185_2404 UPF0227 protein Shew185_2404 Shewanella baltica (strain OS185)
A3D595 9.02e-84 248 66 1 176 3 Sbal_2415 UPF0227 protein Sbal_2415 Shewanella baltica (strain OS155 / ATCC BAA-1091)
P59273 1.17e-83 247 66 1 176 3 SO_2251 UPF0227 protein SO_2251 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8E9B6 1.9e-83 247 66 1 176 3 Sbal223_1944 UPF0227 protein Sbal223_1944 Shewanella baltica (strain OS223)
A9L4A0 4.51e-83 246 65 1 176 3 Sbal195_2522 UPF0227 protein Sbal195_2522 Shewanella baltica (strain OS195)
Q0HVQ7 5.98e-82 243 64 1 176 3 Shewmr7_1806 UPF0227 protein Shewmr7_1806 Shewanella sp. (strain MR-7)
A3QDE6 4.85e-81 241 60 1 179 3 Shew_1627 UPF0227 protein Shew_1627 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KNL5 1.88e-80 239 64 2 177 3 Swoo_1808 UPF0227 protein Swoo_1808 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FX70 6.91e-79 235 63 1 176 3 Ssed_2836 UPF0227 protein Ssed_2836 Shewanella sediminis (strain HAW-EB3)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04290
Feature type CDS
Gene ycfP
Product alpha/beta hydrolase YcfP
Location 961525 - 962070 (strand: 1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1990
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05728 Uncharacterised protein family (UPF0227)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3150 General function prediction only (R) R Predicted esterase YcpF, UPF0227 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07000 uncharacterized protein - -

Protein Sequence

MIIYLHGFDSTSPGNHEKVLQLQFIDPDVRFLSYSTLHPRHDMQHLLKETDKLIKSTKQPVLICGVGLGGYWAERIGFLSNIRQVMINPNLFPYENMTDKIDRPEEYLDIATKCIQDFRSKNRDNALVILSRHDEILDNQRSADELSPYYSIIWDETQTHKFKSLSEHLFKIKAFNSKIPA

Flanking regions ( +/- flanking 50bp)

AAAGCGAATCAAATGCTGACCCAATTACAGGAGCAATGGCAGGAGCGCGCATGATTATATATTTACATGGCTTTGATTCCACTAGTCCGGGAAATCATGAGAAGGTATTACAGCTACAGTTTATTGATCCTGATGTCCGTTTTCTCAGTTACAGTACGTTGCATCCACGTCACGATATGCAACATCTACTCAAAGAGACGGATAAACTGATTAAATCGACAAAACAGCCGGTGCTGATTTGTGGTGTTGGATTAGGTGGCTACTGGGCAGAGCGTATCGGTTTTTTATCTAATATTCGCCAAGTAATGATTAACCCCAATCTTTTTCCATATGAAAATATGACTGATAAGATTGATAGACCTGAAGAGTATTTAGATATTGCCACTAAGTGTATTCAAGATTTTCGCTCTAAAAATAGAGACAATGCATTAGTGATTTTATCCCGTCATGATGAGATTTTAGATAACCAGCGTTCTGCTGATGAGTTATCACCTTATTATTCGATTATTTGGGATGAAACGCAGACACATAAGTTCAAAAGCTTGTCAGAACATCTTTTTAAAATTAAAGCATTTAATAGCAAAATCCCCGCTTAAAATTGGCTTATGTAAGATGGACAGAGTGCATTTTGTCCATCTTTTTTTGA