Homologs in group_1955

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14665 FBDBKF_14665 35.7 Morganella morganii S1 cotS Thiamine kinase or a related kinase
EHELCC_15470 EHELCC_15470 35.7 Morganella morganii S2 cotS Thiamine kinase or a related kinase
NLDBIP_16000 NLDBIP_16000 35.7 Morganella morganii S4 cotS Thiamine kinase or a related kinase
LHKJJB_15840 LHKJJB_15840 35.7 Morganella morganii S3 cotS Thiamine kinase or a related kinase
HKOGLL_14960 HKOGLL_14960 35.7 Morganella morganii S5 cotS Thiamine kinase or a related kinase
F4V73_RS07460 F4V73_RS07460 36.0 Morganella psychrotolerans - phosphotransferase

Distribution of the homologs in the orthogroup group_1955

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1955

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8FIN3 1.59e-21 95 28 7 265 3 thiK Thiamine kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1RD48 1.91e-21 94 28 7 265 3 thiK Thiamine kinase Escherichia coli (strain UTI89 / UPEC)
A1AA00 1.91e-21 94 28 7 265 3 thiK Thiamine kinase Escherichia coli O1:K1 / APEC
B7MJ93 1.91e-21 94 28 7 265 3 thiK Thiamine kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TIW8 2.99e-21 94 28 7 264 3 thiK Thiamine kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MTN6 6.94e-21 93 27 7 265 3 thiK Thiamine kinase Escherichia coli O81 (strain ED1a)
Q8X8G6 9.31e-21 92 28 9 267 3 thiK Thiamine kinase Escherichia coli O157:H7
Q32EW6 1.51e-20 92 28 9 267 3 thiK Thiamine kinase Shigella dysenteriae serotype 1 (strain Sd197)
Q31ZG3 2.44e-20 91 27 7 266 3 thiK Thiamine kinase Shigella boydii serotype 4 (strain Sb227)
B1LI38 2.98e-20 91 29 10 269 3 thiK Thiamine kinase Escherichia coli (strain SMS-3-5 / SECEC)
B5BAG8 4.51e-20 90 27 6 269 3 thiK Thiamine kinase Salmonella paratyphi A (strain AKU_12601)
Q5PGS9 4.51e-20 90 27 6 269 3 thiK Thiamine kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P75948 4.75e-20 90 27 7 266 1 thiK Thiamine kinase Escherichia coli (strain K12)
B1XA16 4.75e-20 90 27 7 266 3 thiK Thiamine kinase Escherichia coli (strain K12 / DH10B)
C4ZS46 4.75e-20 90 27 7 266 3 thiK Thiamine kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B1IUF9 5.81e-20 90 27 7 266 3 thiK Thiamine kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ64 5.81e-20 90 27 7 266 3 thiK Thiamine kinase Escherichia coli O9:H4 (strain HS)
A9N5J7 6.11e-20 90 27 7 269 3 thiK Thiamine kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T340 6.11e-20 90 27 7 269 3 thiK Thiamine kinase Salmonella newport (strain SL254)
C0Q785 8.27e-20 90 27 7 269 3 thiK Thiamine kinase Salmonella paratyphi C (strain RKS4594)
Q57QE7 8.27e-20 90 27 7 269 3 thiK Thiamine kinase Salmonella choleraesuis (strain SC-B67)
B5YVX5 8.44e-20 90 27 7 266 3 thiK Thiamine kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
B4TTH8 8.78e-20 90 27 6 269 3 thiK Thiamine kinase Salmonella schwarzengrund (strain CVM19633)
A7ZKL0 1.43e-19 89 27 7 266 3 thiK Thiamine kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8Z7I7 1.51e-19 89 27 6 269 3 thiK Thiamine kinase Salmonella typhi
B5F8E6 1.51e-19 89 27 6 269 3 thiK Thiamine kinase Salmonella agona (strain SL483)
B5QXC8 1.95e-19 89 27 6 269 3 thiK Thiamine kinase Salmonella enteritidis PT4 (strain P125109)
B5FK99 1.95e-19 89 27 6 269 3 thiK Thiamine kinase Salmonella dublin (strain CT_02021853)
B4TFI3 2.01e-19 89 27 6 269 3 thiK Thiamine kinase Salmonella heidelberg (strain SL476)
Q83LH9 2.31e-19 89 27 7 266 3 thiK Thiamine kinase Shigella flexneri
Q0T5T0 2.31e-19 89 27 7 266 3 thiK Thiamine kinase Shigella flexneri serotype 5b (strain 8401)
Q8ZQ07 2.91e-19 88 27 7 278 3 thiK Thiamine kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3Z311 8.04e-19 87 27 7 266 3 thiK Thiamine kinase Shigella sonnei (strain Ss046)
B5RB94 1.31e-18 87 27 6 269 3 thiK Thiamine kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B7NAY4 2e-18 86 26 5 263 3 thiK Thiamine kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7UPC2 2e-18 86 26 5 263 3 thiK Thiamine kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P43052 1.37e-06 52 27 4 165 3 licA Protein LicA homolog Metamycoplasma hominis (strain ATCC 23114 / DSM 25592 / NBRC 14850 / NCTC 10111 / PG21)
P43044 1.61e-05 48 21 8 217 3 licA Protein LicA homolog Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P71392 0.000744 43 38 0 57 3 licA Protein LicA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04280
Feature type CDS
Gene -
Product phosphotransferase
Location 959559 - 960470 (strand: 1)
Length 912 (nucleotides) / 303 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1955
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01633 Choline/ethanolamine kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0510 Coenzyme transport and metabolism (H) H Thiamine kinase or a related kinase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07251 thiamine kinase [EC:2.7.1.89] Thiamine metabolism
Metabolic pathways		 -

Protein Sequence

MSKSYQQQLLSLLREWFPAIPLSQWQITALAGLGGGTFRLQSNGIDWVARYYGTEKTALFVRAKKESSILKQLLNTQLAPNIIKRHGAWFFFQWLEGEHLTHQQLFDPHLKSLAHQIAKLHQQKPFGFPLDLWHELSVYWYHIDRKRLSPKWLRLHHDFLRQPRRTLIKYAPAHMDLHPENILLSDSGIKFIDWEYAADIDTADSLMTFFAANQLNSAQQTAFLHEYCAYHHYTELNNDQQNRQHPQQQPFYSVNVLKQRILLREPFILYMMLMWYEVRWQQTKDNAFLAMSEPLRRYFSLMN

Flanking regions ( +/- flanking 50bp)

ATTAATGTCGGTTGCGAGCGGAGAAATACTCTGGAGCGGGCGCCATAAGGTTGAGTAAGTCTTATCAACAACAGTTATTGAGCCTATTGCGGGAATGGTTTCCCGCAATACCCTTATCACAGTGGCAAATAACCGCCTTAGCGGGATTAGGGGGCGGCACTTTTCGTTTGCAAAGTAATGGGATAGATTGGGTTGCTCGTTATTATGGCACTGAAAAAACGGCACTTTTTGTCAGGGCTAAAAAAGAGTCTTCGATTTTAAAACAGTTATTAAATACTCAGCTTGCACCAAATATTATTAAACGCCATGGTGCATGGTTTTTTTTCCAGTGGCTAGAGGGTGAGCATCTTACTCATCAGCAGTTATTTGACCCCCATCTCAAATCATTAGCTCATCAAATTGCTAAGTTACATCAGCAAAAACCTTTTGGGTTTCCTCTTGATTTGTGGCATGAACTTTCAGTCTATTGGTATCATATTGACAGAAAACGATTATCACCAAAGTGGTTACGTTTACATCACGATTTTTTACGTCAACCTCGACGTACACTCATAAAATACGCGCCAGCTCACATGGATCTTCATCCTGAGAATATTCTTCTGAGCGATTCAGGTATAAAATTTATTGATTGGGAATATGCCGCTGATATTGATACGGCAGATTCATTAATGACATTTTTTGCCGCAAATCAGTTAAACAGCGCACAACAAACAGCATTTTTACATGAGTATTGTGCATATCATCACTATACTGAATTAAATAATGATCAGCAAAATAGGCAACACCCACAACAGCAGCCGTTTTATTCGGTTAACGTATTAAAGCAGCGTATTTTATTAAGAGAACCCTTTATCTTGTATATGATGCTGATGTGGTATGAGGTTCGTTGGCAACAAACCAAAGATAACGCGTTTTTGGCTATGTCTGAACCTTTACGTCGCTATTTTAGTCTGATGAATTGAAAAGATTTTATTATTGCAATAACAAAGAGAGGAATGTTATGGGTCCTGTA