Homologs in group_387

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14860 FBDBKF_14860 34.0 Morganella morganii S1 - Type 1 fimbrial protein
EHELCC_15665 EHELCC_15665 34.0 Morganella morganii S2 - Type 1 fimbrial protein
NLDBIP_16195 NLDBIP_16195 34.0 Morganella morganii S4 - Type 1 fimbrial protein
LHKJJB_15645 LHKJJB_15645 34.0 Morganella morganii S3 - Type 1 fimbrial protein
HKOGLL_14765 HKOGLL_14765 34.0 Morganella morganii S5 - Type 1 fimbrial protein
F4V73_RS07660 F4V73_RS07660 30.2 Morganella psychrotolerans - hypothetical protein
PMI_RS04090 PMI_RS04090 26.5 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_387

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_387

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1T0 4.26e-05 42 25 4 94 3 ymdA Uncharacterized protein YmdA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1T1 4.26e-05 42 25 4 94 3 ymdA Uncharacterized protein YmdA Salmonella typhi

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04095
Feature type CDS
Gene -
Product hypothetical protein
Location 916160 - 916486 (strand: 1)
Length 327 (nucleotides) / 108 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_387
Orthogroup size 8
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MKKYLTILCSLLVSSSISFAWASTAQQTTGQIYVRGAIVDPACEINFTLDQAEYQCYKNNKVFTSTQSIFPTSFEQSSSIILPQNMGKAEIRWMDGAEKNGLINVQYF

Flanking regions ( +/- flanking 50bp)

GAGTAGGCGTGATCCTCATACCTACTGCGCAAACAAGAAGTGAGGTCGTTATGAAAAAATATCTGACCATTTTATGCAGTCTTCTCGTTTCCAGTTCGATATCATTTGCTTGGGCGTCAACAGCACAGCAAACCACAGGACAGATTTATGTACGAGGAGCGATTGTTGATCCAGCTTGTGAAATTAATTTCACACTCGATCAAGCTGAGTACCAATGTTACAAAAATAACAAAGTCTTTACATCAACCCAGTCTATTTTCCCTACCTCTTTTGAACAATCATCATCAATTATACTGCCTCAAAATATGGGGAAAGCTGAAATCCGTTGGATGGATGGCGCTGAAAAAAATGGATTGATTAATGTGCAATATTTTTAATTGTGTATTGACAGGGAATGATTAGGTAAACAAGTCAAATAATCGTTGTC