Homologs in group_3830

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS06010 F4V73_RS06010 50.8 Morganella psychrotolerans - type II toxin-antitoxin system HicA family toxin

Distribution of the homologs in the orthogroup group_3830

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3830

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04015
Feature type CDS
Gene -
Product type II toxin-antitoxin system HicA family toxin
Location 901989 - 902174 (strand: -1)
Length 186 (nucleotides) / 61 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3830
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF07927 HicA toxin of bacterial toxin-antitoxin,

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1724 General function prediction only (R) R Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07339 mRNA interferase HicA [EC:3.1.-.-] - -

Protein Sequence

MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN

Flanking regions ( +/- flanking 50bp)

TACGTCTTAGTGTGTATAGTGTGTATATCAGTTGACGGAATGGAGGGAGTTTGAAAAGTTCGGAACTGATTAAGTTGTTAGAAAAAAACGGATGGATACTTGATAGAATAAAAGGAAGTCATCATCAATTTACTCACCCTGATTTTTCTTTTGTTGTAACAGTACCGCATCCAAGAAAAGATTTAAAAAAAGGAACATTAAATCAAATTATTAAAAGTGCCAAACTGAAAAATTAATTAAGAATGCGCTCATATAGGGCGCGCTCTTTATGGAGATGAAATTATGT