Homologs in group_3831
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS06015 | F4V73_RS06015 | 49.2 | Morganella psychrotolerans | - | type II toxin-antitoxin system HicB family antitoxin |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P51716 | 1.07e-24 | 94 | 38 | 2 | 133 | 4 | None | Uncharacterized 14.9 kDa protein in rep-hol intergenic region | Haemophilus phage HP1 (strain HP1c1) |
| Q7MZD8 | 1.46e-05 | 45 | 34 | 1 | 81 | 3 | hicB2 | Antitoxin HicB 2 | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS04010 |
| Feature type | CDS |
| Gene | - |
| Product | type II toxin-antitoxin system HicB family antitoxin |
| Location | 901529 - 901942 (strand: -1) |
| Length | 414 (nucleotides) / 137 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3831 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF15919 | HicB_like antitoxin of bacterial toxin-antitoxin system |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG1598 | Defense mechanisms (V) | V | Antitoxin component HicB of the HicAB toxin-antitoxin system |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K18843 | antitoxin HicB | - | - |
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWLLVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
TTAATTAAGAATGCGCTCATATAGGGCGCGCTCTTTATGGAGATGAAATTATGTTATATCCAGCCTTTATTGAAATTGATGAAGATGGTAGCGCAAGTGGCTGGTTCCCTGATATTGATGGTTGCATCTTTGCGGGGGACAGTATTGAAGAAGCTCACGCAGATGCGAGGAGCGCTATTGATGCCCATTTTGAATTGTTAAGCGAGAAGGGTTTAGATATCCCCTCTCCAAAATCTCAACAAGAGCATTTAATTAATTCTAGTGGTGATTACAATAATGGAATATGGCTTTTAGTTGATGTTGATATGGATAAATACGACGGACGAGCAGAGCGTATTAATATCACATTGCCACATCGATTATTGAGTCGCATCGATACTATCGTAAAAACAAATCCTGAATATGGGAGTCGTAGCGGATTTATTGCCACAGCAACCCGTAAAGAACTCCAAAAGAATATTTAATAATAGTTATAAGCCTCGCCTGTATAGGCGAGGTAATCTCTATCATCTTT
