Homologs in group_3831

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS04010 PMI_RS04010 49.2 Proteus mirabilis HI4320 - type II toxin-antitoxin system HicB family antitoxin

Distribution of the homologs in the orthogroup group_3831

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3831

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P51716 5.09e-51 161 52 0 132 4 None Uncharacterized 14.9 kDa protein in rep-hol intergenic region Haemophilus phage HP1 (strain HP1c1)
Q9HK40 5.41e-07 47 43 1 58 3 Ta0767 UPF0150 protein Ta0767 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q7MZD8 2.05e-05 44 29 1 92 3 hicB2 Antitoxin HicB 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P72913 5.17e-05 42 35 1 57 3 ssr1765 UPF0150 protein ssr1765 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O29190 0.000244 40 37 2 59 3 AF_1072 UPF0150 protein AF_1072 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7N1I3 0.00065 40 36 1 58 3 hicB1 Antitoxin HicB 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06015
Feature type CDS
Gene -
Product type II toxin-antitoxin system HicB family antitoxin
Location 1276444 - 1276854 (strand: 1)
Length 411 (nucleotides) / 136 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3831
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF15919 HicB_like antitoxin of bacterial toxin-antitoxin system

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1598 Defense mechanisms (V) V Antitoxin component HicB of the HicAB toxin-antitoxin system

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18843 antitoxin HicB - -

Protein Sequence

MLYPVAIDKSDSSFGVRVPDIPGCFSGGDDYQDAIESAHEAIEAHIELLVEDGEAIPEVTSIEKWVNDPEYAGAVWALVDVDITRLMGKAEKINVTLPSLLIRRIDQFVAQHPEYGSRSGFLAQVAADKVIATERR

Flanking regions ( +/- flanking 50bp)

AAGCATCAAAAAACAGGCGGGGCTTTAAGCCCCTCCTACCGGAGGTTTTAATGTTATATCCCGTTGCTATTGATAAAAGCGATTCATCTTTCGGCGTTCGTGTCCCTGATATTCCGGGCTGCTTTTCTGGTGGTGATGATTATCAGGATGCGATTGAAAGCGCACATGAAGCTATAGAGGCGCATATTGAGTTACTTGTCGAAGATGGCGAGGCTATTCCGGAAGTAACCAGTATCGAAAAGTGGGTTAACGACCCGGAGTATGCCGGTGCGGTTTGGGCGCTGGTTGATGTCGATATTACCCGACTGATGGGGAAAGCGGAGAAGATAAATGTAACTCTGCCCTCACTGCTGATCCGCCGTATCGATCAGTTTGTCGCTCAGCATCCCGAATACGGTAGCCGCTCCGGCTTTCTTGCCCAGGTAGCGGCGGATAAGGTTATTGCGACAGAGAGAAGGTAAATACGGATGTATGCCCCTTGACTGCGGTGTGGTTGAGGGGTTTTGAAGCG