Homologs in group_4839

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4839

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4839

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z3B4 8.26e-08 50 36 0 71 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
Q9L6N6 1.35e-07 50 35 0 71 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AG37 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 3.71e-07 48 32 0 76 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
O05406 1.21e-05 44 28 0 77 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
Q9KVK7 1.57e-05 44 28 1 85 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04000
Feature type CDS
Gene -
Product LysE family transporter
Location 900326 - 900598 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4839
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Protein Sequence

MAAGNPKAILIFTAFLPQFVSPQLPASSQFLILGSLFLLLEFIAIMLYAWLGLHMKKLQKKPHAKKVFNRMCSSLLASAGIGLLVSQKSH

Flanking regions ( +/- flanking 50bp)

CTTCATCTTAATTACGAGTAATAACCTTATTAGCAAGGCAAGAGTTTTTTATTGCAGCAGGAAATCCAAAGGCAATACTTATCTTTACGGCCTTTCTTCCGCAATTCGTTAGCCCACAATTACCGGCTAGTTCCCAGTTTCTAATACTTGGTTCTTTATTCTTGTTACTCGAGTTTATTGCAATAATGCTCTACGCTTGGTTAGGCTTACACATGAAAAAGTTGCAAAAAAAACCACATGCTAAAAAAGTGTTCAATCGTATGTGCTCAAGTTTATTAGCTAGTGCAGGGATTGGGCTTTTAGTTTCACAGAAAAGCCATTAAATAACACCACACGCTGAGTAAACAGTCGCCTTTTATAAAGGTAAAGGCGA