Homologs in group_199

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11820 FBDBKF_11820 16.3 Morganella morganii S1 rhtB Threonine/homoserine/homoserine lactone efflux protein
EHELCC_14485 EHELCC_14485 16.3 Morganella morganii S2 rhtB Threonine/homoserine/homoserine lactone efflux protein
NLDBIP_15580 NLDBIP_15580 16.3 Morganella morganii S4 rhtB Threonine/homoserine/homoserine lactone efflux protein
LHKJJB_15030 LHKJJB_15030 16.3 Morganella morganii S3 rhtB Threonine/homoserine/homoserine lactone efflux protein
HKOGLL_14150 HKOGLL_14150 16.3 Morganella morganii S5 rhtB Threonine/homoserine/homoserine lactone efflux protein
F4V73_RS14830 F4V73_RS14830 17.4 Morganella psychrotolerans - LysE family translocator
PMI_RS06140 PMI_RS06140 28.2 Proteus mirabilis HI4320 - LysE family transporter
PMI_RS13905 PMI_RS13905 20.9 Proteus mirabilis HI4320 - LysE family translocator

Distribution of the homologs in the orthogroup group_199

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_199

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z3B4 8.26e-08 50 36 0 71 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
Q9L6N6 1.35e-07 50 35 0 71 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AG37 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 3.71e-07 48 32 0 76 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 3.71e-07 48 32 0 76 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
O05406 1.21e-05 44 28 0 77 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
Q9KVK7 1.57e-05 44 28 1 85 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04000
Feature type CDS
Gene -
Product LysE family transporter
Location 900326 - 900598 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_199
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Protein Sequence

MAAGNPKAILIFTAFLPQFVSPQLPASSQFLILGSLFLLLEFIAIMLYAWLGLHMKKLQKKPHAKKVFNRMCSSLLASAGIGLLVSQKSH

Flanking regions ( +/- flanking 50bp)

CTTCATCTTAATTACGAGTAATAACCTTATTAGCAAGGCAAGAGTTTTTTATTGCAGCAGGAAATCCAAAGGCAATACTTATCTTTACGGCCTTTCTTCCGCAATTCGTTAGCCCACAATTACCGGCTAGTTCCCAGTTTCTAATACTTGGTTCTTTATTCTTGTTACTCGAGTTTATTGCAATAATGCTCTACGCTTGGTTAGGCTTACACATGAAAAAGTTGCAAAAAAAACCACATGCTAAAAAAGTGTTCAATCGTATGTGCTCAAGTTTATTAGCTAGTGCAGGGATTGGGCTTTTAGTTTCACAGAAAAGCCATTAAATAACACCACACGCTGAGTAAACAGTCGCCTTTTATAAAGGTAAAGGCGA