Homologs in group_1265

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07375 FBDBKF_07375 82.1 Morganella morganii S1 hspQ heat shock protein HspQ
EHELCC_03595 EHELCC_03595 82.1 Morganella morganii S2 hspQ heat shock protein HspQ
NLDBIP_03595 NLDBIP_03595 82.1 Morganella morganii S4 hspQ heat shock protein HspQ
LHKJJB_09425 LHKJJB_09425 82.1 Morganella morganii S3 hspQ heat shock protein HspQ
HKOGLL_09550 HKOGLL_09550 82.1 Morganella morganii S5 hspQ heat shock protein HspQ
F4V73_RS01560 F4V73_RS01560 80.2 Morganella psychrotolerans hspQ heat shock protein HspQ

Distribution of the homologs in the orthogroup group_1265

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1265

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ET62 5.19e-75 219 100 0 106 3 hspQ Heat shock protein HspQ Proteus mirabilis (strain HI4320)
Q7N5Z3 5.22e-61 184 81 0 106 3 hspQ Heat shock protein HspQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AIB1 5.33e-56 171 76 0 105 3 hspQ Heat shock protein HspQ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CQT0 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFC1 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella typhi
B4TSJ1 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella schwarzengrund (strain CVM19633)
C0Q8C6 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi C (strain RKS4594)
A9N6W1 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T208 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella newport (strain SL254)
B4TE05 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella heidelberg (strain SL476)
B5R6D2 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZG9 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella enteritidis PT4 (strain P125109)
B5FR08 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella dublin (strain CT_02021853)
B5F1W2 2.59e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Salmonella agona (strain SL483)
A7ME45 2.71e-55 170 75 0 105 3 hspQ Heat shock protein HspQ Cronobacter sakazakii (strain ATCC BAA-894)
A6T765 3.68e-55 169 74 0 105 3 hspQ Heat shock protein HspQ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY39 3.68e-55 169 74 0 105 3 hspQ Heat shock protein HspQ Klebsiella pneumoniae (strain 342)
B5BBK1 3.89e-55 169 75 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi A (strain AKU_12601)
Q5PGB5 3.89e-55 169 75 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MHS3 3.89e-55 169 75 0 105 3 hspQ Heat shock protein HspQ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8GCM7 2.59e-54 167 73 0 105 3 hspQ Heat shock protein HspQ Serratia proteamaculans (strain 568)
Q57QS4 2.86e-54 167 74 0 105 3 hspQ Heat shock protein HspQ Salmonella choleraesuis (strain SC-B67)
Q3Z3F4 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Shigella sonnei (strain Ss046)
P0AB23 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Shigella flexneri
Q0T668 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Shigella flexneri serotype 5b (strain 8401)
Q31YM9 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Shigella boydii serotype 4 (strain Sb227)
B2TTS8 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDP6 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain UTI89 / UPEC)
B1LJ31 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain SMS-3-5 / SECEC)
B6I941 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain SE11)
B7N3C9 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AB20 2.2e-53 165 74 0 105 1 hspQ Heat shock protein HspQ Escherichia coli (strain K12)
B1IVW6 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB21 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ94 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9N5 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O1:K1 / APEC
B1X8S0 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain K12 / DH10B)
C4ZQ92 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain K12 / MC4100 / BW2952)
B7M895 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O8 (strain IAI1)
B7MS77 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O81 (strain ED1a)
B7NLF0 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT97 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB22 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O157:H7
B7LE66 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain 55989 / EAEC)
B7MIC0 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN45 2.2e-53 165 74 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A1JMW1 4.3e-53 164 73 0 105 3 hspQ Heat shock protein HspQ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JQP7 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CE1 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKV5 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis (strain Pestoides F)
Q1CGL7 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2N8 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Angola)
Q7CHM0 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis
B2JYU3 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA18 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJR9 1.73e-52 162 72 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NU66 3.1e-52 162 71 0 105 3 hspQ Heat shock protein HspQ Sodalis glossinidius (strain morsitans)
Q1LT59 3.57e-52 162 71 0 105 3 hspQ Heat shock protein HspQ Baumannia cicadellinicola subsp. Homalodisca coagulata
B7LNX6 1.7e-51 160 70 0 105 3 hspQ Heat shock protein HspQ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32HU0 2.6e-51 159 72 0 105 3 hspQ Heat shock protein HspQ Shigella dysenteriae serotype 1 (strain Sd197)
Q492P5 1.3e-50 158 68 0 105 3 hspQ Heat shock protein HspQ Blochmanniella pennsylvanica (strain BPEN)
Q8D251 4.46e-49 154 64 0 105 3 hspQ Heat shock protein HspQ Wigglesworthia glossinidia brevipalpis
B2VDG6 2.07e-48 152 68 0 105 3 hspQ Heat shock protein HspQ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7VR10 3.21e-48 152 65 0 105 3 hspQ Heat shock protein HspQ Blochmanniella floridana
C6DKX0 1.76e-40 132 60 2 105 3 hspQ Heat shock protein HspQ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D6C5 3.67e-39 129 59 2 105 3 hspQ Heat shock protein HspQ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03890
Feature type CDS
Gene hspQ
Product heat shock protein HspQ
Location 881720 - 882040 (strand: -1)
Length 321 (nucleotides) / 106 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1265
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08755 Hemimethylated DNA-binding protein YccV like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3785 Posttranslational modification, protein turnover, chaperones (O) O Heat shock protein HspQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11940 heat shock protein HspQ - -

Protein Sequence

MMIASKFGIGQQVRHKLLGYLGVVVDVDAEYSLDQPNEDDIASNMTLRSAPWYHVVMEDDEGQPVHTYLAEAQITYELSDEHLDNDSMDELSQSIRNQLQAPRLRN

Flanking regions ( +/- flanking 50bp)

ATGCCCTCATATACAGAAATTAATAAAGCAAGGTTTTACGGAGGTGATAAATGATGATCGCCAGCAAATTTGGAATAGGCCAGCAGGTTAGACATAAACTACTCGGTTATTTAGGTGTAGTTGTTGATGTGGATGCTGAATATTCCCTTGATCAACCTAACGAGGATGATATTGCATCTAATATGACCTTGCGATCAGCGCCTTGGTATCATGTTGTCATGGAAGATGATGAAGGACAACCGGTTCATACCTATTTAGCTGAAGCTCAAATAACTTATGAACTCTCAGATGAGCATTTAGATAATGACTCAATGGATGAGTTGTCACAATCAATCCGCAACCAATTACAGGCCCCGCGATTAAGAAACTAATTTTCTTCCATTCTTAACCTTAATGATAATCGCCGAATACATTTCGGCGA