Homologs in group_1324

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07375 FBDBKF_07375 100.0 Morganella morganii S1 hspQ heat shock protein HspQ
EHELCC_03595 EHELCC_03595 100.0 Morganella morganii S2 hspQ heat shock protein HspQ
NLDBIP_03595 NLDBIP_03595 100.0 Morganella morganii S4 hspQ heat shock protein HspQ
LHKJJB_09425 LHKJJB_09425 100.0 Morganella morganii S3 hspQ heat shock protein HspQ
F4V73_RS01560 F4V73_RS01560 95.3 Morganella psychrotolerans hspQ heat shock protein HspQ
PMI_RS03890 PMI_RS03890 82.1 Proteus mirabilis HI4320 hspQ heat shock protein HspQ

Distribution of the homologs in the orthogroup group_1324

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1324

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ET62 1.45e-63 191 82 0 106 3 hspQ Heat shock protein HspQ Proteus mirabilis (strain HI4320)
Q7N5Z3 1.17e-59 181 77 0 106 3 hspQ Heat shock protein HspQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7ME45 1.62e-55 170 73 0 105 3 hspQ Heat shock protein HspQ Cronobacter sakazakii (strain ATCC BAA-894)
A6T765 4.95e-54 166 71 0 105 3 hspQ Heat shock protein HspQ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY39 4.95e-54 166 71 0 105 3 hspQ Heat shock protein HspQ Klebsiella pneumoniae (strain 342)
A8GCM7 7.11e-54 166 70 0 105 3 hspQ Heat shock protein HspQ Serratia proteamaculans (strain 568)
B5BBK1 7.11e-54 166 71 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi A (strain AKU_12601)
Q5PGB5 7.11e-54 166 71 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MHS3 7.11e-54 166 71 0 105 3 hspQ Heat shock protein HspQ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CQT0 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFC1 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella typhi
B4TSJ1 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella schwarzengrund (strain CVM19633)
C0Q8C6 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi C (strain RKS4594)
A9N6W1 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T208 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella newport (strain SL254)
B4TE05 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella heidelberg (strain SL476)
B5R6D2 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZG9 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella enteritidis PT4 (strain P125109)
B5FR08 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella dublin (strain CT_02021853)
B5F1W2 4.35e-53 164 70 0 105 3 hspQ Heat shock protein HspQ Salmonella agona (strain SL483)
A8AIB1 9.9e-53 163 69 0 105 3 hspQ Heat shock protein HspQ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LNX6 1.81e-52 162 71 0 105 3 hspQ Heat shock protein HspQ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1LT59 1.91e-52 162 70 0 105 3 hspQ Heat shock protein HspQ Baumannia cicadellinicola subsp. Homalodisca coagulata
Q57QS4 3.99e-52 162 69 0 105 3 hspQ Heat shock protein HspQ Salmonella choleraesuis (strain SC-B67)
Q2NU66 4.6e-52 161 71 0 105 3 hspQ Heat shock protein HspQ Sodalis glossinidius (strain morsitans)
Q3Z3F4 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Shigella sonnei (strain Ss046)
P0AB23 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Shigella flexneri
Q0T668 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Shigella flexneri serotype 5b (strain 8401)
Q31YM9 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Shigella boydii serotype 4 (strain Sb227)
B2TTS8 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDP6 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain UTI89 / UPEC)
B1LJ31 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain SMS-3-5 / SECEC)
B6I941 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain SE11)
B7N3C9 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AB20 8.69e-52 161 68 0 105 1 hspQ Heat shock protein HspQ Escherichia coli (strain K12)
B1IVW6 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB21 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ94 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9N5 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O1:K1 / APEC
B1X8S0 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain K12 / DH10B)
C4ZQ92 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain K12 / MC4100 / BW2952)
B7M895 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O8 (strain IAI1)
B7MS77 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O81 (strain ED1a)
B7NLF0 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT97 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB22 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O157:H7
B7LE66 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli (strain 55989 / EAEC)
B7MIC0 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UN45 8.69e-52 161 68 0 105 3 hspQ Heat shock protein HspQ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q492P5 1.22e-50 158 68 0 105 3 hspQ Heat shock protein HspQ Blochmanniella pennsylvanica (strain BPEN)
B1JQP7 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CE1 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKV5 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis (strain Pestoides F)
Q1CGL7 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2N8 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Angola)
Q7CHM0 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis
B2JYU3 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA18 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJR9 2e-50 157 67 0 105 3 hspQ Heat shock protein HspQ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32HU0 1.11e-49 155 66 0 105 3 hspQ Heat shock protein HspQ Shigella dysenteriae serotype 1 (strain Sd197)
A1JMW1 1.77e-49 155 66 0 105 3 hspQ Heat shock protein HspQ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7VR10 7.97e-49 153 67 0 105 3 hspQ Heat shock protein HspQ Blochmanniella floridana
Q8D251 2.61e-48 152 62 0 105 3 hspQ Heat shock protein HspQ Wigglesworthia glossinidia brevipalpis
B2VDG6 4.32e-47 149 63 0 105 3 hspQ Heat shock protein HspQ Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DKX0 1.77e-36 122 57 2 105 3 hspQ Heat shock protein HspQ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D6C5 1.91e-35 119 56 2 105 3 hspQ Heat shock protein HspQ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_09550
Feature type CDS
Gene hspQ
Product heat shock protein HspQ
Location 165447 - 165767 (strand: -1)
Length 321 (nucleotides) / 106 (amino acids)
In genomic island -

Contig

Accession ZDB_686
Length 191111 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1324
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08755 Hemimethylated DNA-binding protein YccV like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3785 Posttranslational modification, protein turnover, chaperones (O) O Heat shock protein HspQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11940 heat shock protein HspQ - -

Protein Sequence

MMISSKFGIGQQVRHKLLGYLGVIVDIDAEYSLDQPEEDDIASNMNLRSAPWYHVVMEDDNGEPIHSYLAEAQITYEMDEDHPDNITMDELAESIRNQLQSPRLRN

Flanking regions ( +/- flanking 50bp)

ATCAGTACCCCCCATATTAGTAACAGAGCAAAGTTTCTTCGGAGGTGATTATGATGATTTCAAGTAAGTTCGGTATCGGACAACAAGTTCGCCATAAGCTGCTTGGCTACCTGGGCGTGATTGTCGACATTGATGCTGAATACTCACTGGATCAGCCGGAAGAGGACGACATCGCATCCAATATGAACCTGCGCTCTGCGCCCTGGTACCACGTCGTGATGGAAGACGATAACGGTGAGCCTATCCATAGCTATCTGGCAGAAGCCCAGATCACCTATGAGATGGATGAAGACCACCCCGATAACATCACTATGGATGAACTGGCTGAGTCCATCCGCAACCAGTTACAGTCTCCCCGGTTGCGCAATTAACAATACGAAGAGCCCCGCCACTCACATGCCGGGGCTTTATTTTTACTTAC