Homologs in group_1314

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07320 FBDBKF_07320 74.5 Morganella morganii S1 rmf ribosome modulation factor
EHELCC_03650 EHELCC_03650 74.5 Morganella morganii S2 rmf ribosome modulation factor
NLDBIP_03650 NLDBIP_03650 74.5 Morganella morganii S4 rmf ribosome modulation factor
LHKJJB_09480 LHKJJB_09480 74.5 Morganella morganii S3 rmf ribosome modulation factor
HKOGLL_09495 HKOGLL_09495 74.5 Morganella morganii S5 rmf ribosome modulation factor
F4V73_RS01505 F4V73_RS01505 74.5 Morganella psychrotolerans rmf ribosome modulation factor

Distribution of the homologs in the orthogroup group_1314

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1314

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVD2 2.86e-35 115 100 0 56 3 rmf Ribosome modulation factor Proteus mirabilis (strain HI4320)
D3VC10 3.99e-23 85 76 0 51 3 rmf Ribosome modulation factor Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q47UR1 6.66e-21 79 70 0 51 3 rmf2 Ribosome modulation factor 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
F5Z7V5 7.05e-21 79 72 0 51 3 rmf Ribosome modulation factor Alteromonas naphthalenivorans
C4LEL9 1.05e-20 79 72 0 51 3 rmf Ribosome modulation factor Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P0AFW2 1.7e-20 78 67 0 55 1 rmf Ribosome modulation factor Escherichia coli (strain K12)
P0AFW3 1.7e-20 78 67 0 55 3 rmf Ribosome modulation factor Escherichia coli O157:H7
F4DAE8 8.74e-20 76 70 0 51 3 rmf Ribosome modulation factor Aeromonas veronii (strain B565)
A1S605 1.11e-19 76 66 0 51 3 rmf Ribosome modulation factor Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8GCL2 4.04e-19 75 66 1 56 3 rmf Ribosome modulation factor Serratia proteamaculans (strain 568)
Q47Z13 4.84e-18 72 64 0 51 3 rmf1 Ribosome modulation factor 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C3NQJ0 5.28e-18 72 61 1 57 3 rmf Ribosome modulation factor Vibrio cholerae serotype O1 (strain MJ-1236)
Q5QYY1 1.96e-17 70 65 1 52 3 rmf Ribosome modulation factor Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C7RB40 2.54e-16 67 59 0 49 3 rmf Ribosome modulation factor Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125)
Q0VQU6 2.93e-14 63 50 0 50 3 rmf Ribosome modulation factor Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q21JW8 7.77e-14 62 52 0 50 3 rmf Ribosome modulation factor Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B3PIL7 1.8e-13 61 56 0 51 3 rmf Ribosome modulation factor Cellvibrio japonicus (strain Ueda107)
Q1QXW0 5.66e-13 59 54 0 50 3 rmf Ribosome modulation factor Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
E4PJF6 2.97e-12 57 50 0 51 3 rmf Ribosome modulation factor Marinobacter adhaerens (strain DSM 23420 / HP15)
Q48JX9 2.74e-10 53 46 0 50 3 rmf Ribosome modulation factor Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2SCH0 6.34e-10 52 50 0 50 3 rmf Ribosome modulation factor Hahella chejuensis (strain KCTC 2396)
F2JWN1 6.6e-09 49 54 0 50 3 rmf Ribosome modulation factor Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03835
Feature type CDS
Gene rmf
Product ribosome modulation factor
Location 869509 - 869679 (strand: 1)
Length 171 (nucleotides) / 56 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1314
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04957 Ribosome modulation factor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3130 Translation, ribosomal structure and biogenesis (J) J Ribosome modulation factor

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03812 ribosome modulation factor - -

Protein Sequence

MKRQKRDRLARALSKGYQAGMQGRSKEQCPYFAIDARSHWLGGWRQAMEDRPGLAK

Flanking regions ( +/- flanking 50bp)

AACAATCATTATCTTTCCGCTTAAACTTAGAACGTGAGGGTTGTCTAAATATGAAAAGACAGAAACGAGATCGTTTAGCTAGAGCATTATCGAAAGGTTACCAAGCCGGTATGCAAGGTCGTTCAAAAGAGCAGTGTCCCTATTTTGCCATTGATGCACGTTCACATTGGCTAGGAGGTTGGCGACAGGCCATGGAAGATCGTCCTGGGCTTGCAAAATAAATAACCCGTCGAGGTGATACTGCGGACACCTGTGTTATCGCAAATATTAT