Homologs in group_4940

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4940

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4940

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q75GM1 1.28e-08 53 36 1 77 2 Os05g0480200 Thioredoxin H5 Oryza sativa subsp. japonica
Q38879 7.4e-08 50 33 1 86 1 TRX2 Thioredoxin H2 Arabidopsis thaliana
O64394 8.02e-08 50 30 1 92 2 None Thioredoxin H-type Triticum aestivum
Q98TX1 1.91e-07 49 31 2 95 3 TXN Thioredoxin Ophiophagus hannah
P08628 5.5e-07 48 32 1 88 1 TXN Thioredoxin Oryctolagus cuniculus
P82460 1.7e-06 46 31 1 88 1 TXN Thioredoxin Sus scrofa
P08629 3.04e-06 46 34 2 88 3 TXN Thioredoxin Gallus gallus
P50413 3.64e-06 45 30 1 88 3 TXN Thioredoxin Ovis aries
O97680 3.83e-06 45 30 1 88 3 TXN Thioredoxin Bos taurus
P25372 4.17e-06 46 32 1 70 1 TRX3 Thioredoxin-3, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P10599 4.88e-06 45 32 2 88 1 TXN Thioredoxin Homo sapiens
Q9BDJ3 5.09e-06 45 32 2 86 3 TXN Thioredoxin Callithrix jacchus
O97508 5.2e-06 45 30 1 88 3 TXN Thioredoxin Equus caballus
P29451 6.42e-06 45 30 1 84 3 TXN Thioredoxin Macaca mulatta
Q851R5 7.7e-06 45 30 1 90 2 Os03g0800700 Thioredoxin H2-2 Oryza sativa subsp. japonica
Q6Z4I3 7.93e-06 45 26 1 86 2 Os07g0190800 Thioredoxin H2-1 Oryza sativa subsp. japonica
Q5R9M3 1.03e-05 44 31 3 89 3 TXN Thioredoxin Pongo abelii
A2YIW7 1.08e-05 45 31 1 77 1 TRXH Thioredoxin H-type Oryza sativa subsp. indica
Q0D840 1.08e-05 45 31 1 77 1 TRXH Thioredoxin H1 Oryza sativa subsp. japonica
Q39241 2.11e-05 44 32 0 65 1 TRX5 Thioredoxin H5 Arabidopsis thaliana
P29429 4.1e-05 43 24 3 102 1 TRX1 Thioredoxin Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O14463 5.04e-05 42 29 0 61 3 trx1 Thioredoxin-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P68176 5.97e-05 43 28 0 74 2 BOPC17 Thioredoxin H-type Brassica oleracea
P68177 5.97e-05 43 28 0 74 2 THL-1 Thioredoxin H-type 1 Brassica napus
O64432 6.35e-05 43 28 0 74 2 PEC-2 Thioredoxin H-type Brassica campestris
Q96419 8.32e-05 42 31 1 73 3 None Thioredoxin H-type Fagopyrum esculentum
Q1RQJ1 8.38e-05 42 28 0 59 1 None Thioredoxin Asp f 28 Aspergillus fumigatus
Q69AB2 9.41e-05 42 28 0 63 1 Txndc8 Thioredoxin domain-containing protein 8 Mus musculus
Q39362 0.00013 42 27 2 90 2 THL-2 Thioredoxin H-type 2 Brassica napus
Q9C9Y6 0.000159 42 30 2 88 1 TRX9 Thioredoxin H9 Arabidopsis thaliana
Q9RD25 0.000165 42 25 0 89 2 trxC Putative thioredoxin 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P11232 0.000305 40 27 2 87 1 Txn Thioredoxin Rattus norvegicus
Q42403 0.000352 40 26 0 75 1 TRX3 Thioredoxin H3 Arabidopsis thaliana
Q9AS75 0.000404 40 27 1 85 2 Os01g0168200 Thioredoxin H4-1 Oryza sativa subsp. japonica
Q9CAS1 0.000408 41 31 0 63 2 TRX8 Thioredoxin H8 Arabidopsis thaliana
P10639 0.000417 40 27 2 87 1 Txn Thioredoxin Mus musculus
O65049 0.000543 40 33 1 62 2 SB09 Thioredoxin H-type Picea mariana
Q0DKF1 0.000569 40 29 1 85 2 Os05g0169000 Thioredoxin H4-2 Oryza sativa subsp. japonica
Q86VQ3 0.000615 41 31 2 87 1 TXNDC2 Thioredoxin domain-containing protein 2 Homo sapiens
P22803 0.00062 40 27 2 85 1 TRX2 Thioredoxin-2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P29446 0.000666 39 38 0 42 2 trxB Thioredoxin-2 (Fragment) Dictyostelium discoideum
Q9LXZ8 0.000806 40 26 0 72 3 At3g56420 Putative thioredoxin H10 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03730
Feature type CDS
Gene -
Product thioredoxin family protein
Location 840926 - 841318 (strand: 1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4940
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF00085 Thioredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3118 Posttranslational modification, protein turnover, chaperones (O) O Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family

Protein Sequence

MINYPDLNKDNIRYQSAFGKKLVISFCASWCNNCESWKDTFTLLSEKFIDDCFIWIDIDEYPELVSEIDLDIIPVLLIQKKEDIHFLGPIRPGLETIVSILNSDKVMKVEFDPGIRDYLIAPDLPKRTIY

Flanking regions ( +/- flanking 50bp)

AAATATAATGATTTTTGTTTTTTTAATCGAATTAAAAATAAGGAGTTGATATGATTAATTATCCAGATTTAAATAAAGATAATATTCGCTATCAATCAGCTTTTGGAAAAAAATTAGTAATAAGCTTTTGTGCATCTTGGTGTAATAATTGTGAATCATGGAAAGATACTTTTACGCTACTCTCTGAAAAGTTTATTGATGACTGTTTTATTTGGATTGATATTGATGAATATCCAGAGTTAGTCAGTGAGATTGACCTTGATATAATCCCTGTTCTTCTTATACAAAAAAAAGAGGATATCCATTTTTTGGGCCCCATTAGGCCAGGATTGGAAACAATTGTGAGTATTCTAAATTCAGATAAAGTAATGAAAGTTGAATTTGATCCCGGAATTAGAGATTATTTAATTGCCCCCGACCTCCCTAAAAGGACGATATATTAATTTACTAAAATGAATAATAGGGGAAAGTAACCAAGTGATTGACAATTGAC